Transcription Factor
Accessions: | CG17181 (FlyZincFinger 1.0 ) |
Names: | CG17181 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 144 |
Pfam Domains: | 4-28 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 4-26 C2H2-type zinc finger 18-45 Zinc-finger double domain 36-59 C2H2-type zinc finger 36-58 C2H2-type zinc finger 62-83 C2H2-type zinc finger 62-83 Zinc finger, C2H2 type 62-83 C2H2-type zinc finger 76-99 Zinc-finger double domain 89-109 Zinc-finger of C2H2 type 89-112 C2H2-type zinc finger 89-111 Zinc finger, C2H2 type 89-111 C2H2-type zinc finger 103-127 Zinc-finger double domain 116-126 C2H2-type zinc finger 117-138 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 EDEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQG 60 61 CECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCA 120 121 RCGKAFALKSYLYKHEESSCMKNR |
Interface Residues: | 14, 15, 17, 18, 21, 25, 46, 47, 48, 49, 51, 52, 54, 55, 58, 71, 72, 73, 74, 75, 78, 86, 99, 100, 101, 102, 103, 105, 106, 107, 110, 127, 128, 129, 130, 131, 132, 133, 134, 135 |
3D-footprint Homologues: | 7w1m_H, 8ssu_A, 1ubd_C, 5kkq_D, 5ei9_F, 6wmi_A, 8ssq_A, 2i13_A, 5yel_A, 5k5l_F, 6ml4_A, 6blw_A, 7eyi_G, 2lt7_A, 7ysf_A, 2jpa_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 3uk3_C, 1tf6_A, 5und_A, 2gli_A, 1llm_D, 5v3j_F, 4x9j_A, 1mey_C, 1f2i_J, 6u9q_A, 5kl3_A, 1g2f_F, 5k5i_A, 2kmk_A, 8h9h_G, 7y3m_I, 6e94_A, 6a57_A, 8gn3_A, 1yuj_A, 2wbs_A, 7txc_E, 2drp_D, 5yj3_D, 4m9v_C |
Binding Motifs: | CG17181_SANGER_5_FBgn0035144 rCCACCTGT CG17181_SOLEXA_5_FBgn0035144 aaCCACCTGTtrmmm |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.