Transcription Factor

Accessions: CG17181 (FlyZincFinger 1.0 )
Names: CG17181
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 144
Pfam Domains: 4-28 C2H2-type zinc finger
4-26 Zinc finger, C2H2 type
4-26 C2H2-type zinc finger
18-45 Zinc-finger double domain
36-59 C2H2-type zinc finger
36-58 C2H2-type zinc finger
62-83 C2H2-type zinc finger
62-83 C2H2-type zinc finger
62-83 Zinc finger, C2H2 type
76-99 Zinc-finger double domain
89-111 Zinc finger, C2H2 type
89-111 C2H2-type zinc finger
89-109 Zinc-finger of C2H2 type
89-112 C2H2-type zinc finger
103-127 Zinc-finger double domain
116-126 C2H2-type zinc finger
117-138 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EDEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQG 60
61 CECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCA 120
121 RCGKAFALKSYLYKHEESSCMKNR
Interface Residues: 14, 15, 17, 18, 21, 25, 46, 47, 48, 49, 51, 52, 54, 55, 58, 71, 72, 73, 74, 75, 78, 86, 99, 100, 101, 102, 103, 105, 106, 110, 127, 128, 129, 130, 131, 133, 134
3D-footprint Homologues: 7w1m_H, 1ubd_C, 8ssq_A, 8ssu_A, 2lt7_A, 7ysf_A, 2jpa_A, 7y3l_A, 7n5w_A, 1tf3_A, 8cuc_F, 1tf6_A, 2gli_A, 5v3j_F, 2kmk_A, 6u9q_A, 8h9h_G, 7y3m_I, 6e94_A, 8gn3_A, 1yuj_A, 7txc_E, 2drp_D
Binding Motifs: CG17181_SANGER_5_FBgn0035144 rCCACCTGT
CG17181_SOLEXA_5_FBgn0035144 aaCCACCTGTtrmmm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.