Transcription Factor
| Accessions: | 4hn5_A (3D-footprint 20250804), 5e6c_B (3D-footprint 20250804), 6bse_B (3D-footprint 20250804) |
| Names: | GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1, GCR_SAGOE |
| Organisms: | Homo sapiens, Saguinus oedipus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P04150 |
| Length: | 72 |
| Pfam Domains: | 1-69 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRY 60 61 RKCLQAGMNLEA |
| Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1a6y_A, 1lo1_A, 3g9m_B, 4oln_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 4hn5_AB CCnGnnGC 5e6c_AB AAtnTCCA 6bse_AB GnaCAnnngG |
| Binding Sites: | 5e6c_C 5e6c_D 6bse_C 6bse_D |
| Publications: | Hudson W.H, Youn C, Ortlund E.A. The structural basis of direct glucocorticoid-mediated transrepression. Nature structural & molecular biology 20:53-8 (2013). [Pubmed] Hudson WH, Vera IMS, Nwachukwu JC, Weikum ER, Herbst AG, Yang Q, Bain DL, Nettles KW, Kojetin DJ, Ortlund EA. Cryptic glucocorticoid receptor-binding sites pervade genomic NF-κB response elements. Nat Commun 9:1337 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.