Transcription Factor
| Accessions: | Q8N2R0 (JASPAR 2024) |
| Names: | OSR2_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q8N2R0 |
| Length: | 312 |
| Pfam Domains: | 172-189 C2H2-type zinc finger 172-194 Zinc finger, C2H2 type 172-194 C2H2-type zinc finger 186-210 Zinc-finger double domain 199-220 C2H2-type zinc finger 200-222 Zinc finger, C2H2 type 200-222 C2H2-type zinc finger 214-237 Zinc-finger double domain 228-252 C2H2-type zinc finger 228-250 Zinc finger, C2H2 type 245-266 Zinc-finger double domain 255-274 C2H2-type zinc finger 256-278 Zinc finger, C2H2 type 256-278 C2H2-type zinc finger 270-294 Zinc-finger double domain 284-294 C2H2-type zinc finger 284-306 Zinc finger, C2H2 type 284-306 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPN 60 61 VHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN 120 121 LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRH 180 181 FTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS 240 241 RTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLR 300 301 RHSLTHTPRQDF |
| Interface Residues: | 44, 46, 182, 183, 184, 185, 186, 188, 189, 196, 197, 200, 210, 211, 212, 213, 214, 216, 217, 219, 220, 221, 223, 238, 239, 240, 241, 242, 243, 245, 246, 247, 249, 266, 267, 268, 269, 270, 271, 272, 273, 274, 295, 296, 297, 298, 300, 301 |
| 3D-footprint Homologues: | 4kdp_B, 7y3l_A, 5v3j_F, 7n5w_A, 1tf3_A, 3uk3_C, 8cuc_F, 8ssu_A, 6blw_A, 5kkq_D, 6u9q_A, 4x9j_A, 5kl3_A, 1g2f_F, 5ei9_F, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 1llm_D, 8h9h_G, 7eyi_G, 2lt7_A, 2i13_A, 7y3m_I, 6e94_A, 7ysf_A, 6wmi_A, 1yuj_A, 2kmk_A, 5k5i_A, 6ml4_A, 2wbs_A, 1f2i_J, 5yel_A, 8ssq_A, 2jpa_A, 1ubd_C, 6jnm_A, 1mey_C, 4m9v_C, 6a57_A, 8gn3_A, 7txc_E, 2drp_D, 5yj3_D |
| Binding Motifs: | MA1646.1 amaCAGAAGChr MA1646.2 aCAGAAGC |
| Binding Sites: | MA1646.2.12 / MA1646.2.7 MA1646.2.9 MA1646.2.1 MA1646.1.1 MA1646.1.10 MA1646.1.11 / MA1646.1.6 MA1646.1.12 / MA1646.1.7 MA1646.1.13 MA1646.1.14 / MA1646.1.8 MA1646.1.15 MA1646.1.16 MA1646.1.17 / MA1646.1.9 MA1646.1.18 MA1646.1.19 MA1646.1.1 / MA1646.1.2 MA1646.1.20 MA1646.1.2 / MA1646.1.3 MA1646.1.4 MA1646.1.5 MA1646.1.3 / MA1646.1.6 MA1646.1.4 / MA1646.1.7 MA1646.1.5 / MA1646.1.8 MA1646.1.9 MA1646.1.10 MA1646.1.11 MA1646.1.12 MA1646.1.13 MA1646.1.14 MA1646.1.15 MA1646.1.16 MA1646.1.17 MA1646.1.18 MA1646.1.19 MA1646.1.20 MA1646.2.10 MA1646.2.11 / MA1646.2.4 MA1646.2.13 MA1646.2.14 MA1646.2.15 / MA1646.2.17 MA1646.2.16 MA1646.2.18 MA1646.2.19 / MA1646.2.20 MA1646.2.2 MA1646.2.3 MA1646.2.5 MA1646.2.6 MA1646.2.8 |
| Publications: | Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.