Transcription Factor

Accessions: 2e42_B (3D-footprint 20241219)
Names: C/EBP beta, CCAAT/enhancer-binding protein beta, CEBPB_HUMAN, LAP, LIP, Liver activator protein, Liver-enriched inhibitory protein, Nuclear factor NF-IL6, TCF-5, Transcription factor 5
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17676
Length: 67
Pfam Domains: 3-56 Basic region leucine zipper
4-62 bZIP transcription factor
Sequence:
(in bold interface residues)
1 DKHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTL 60
61 RNLFKQL
Interface Residues: 11, 14, 15, 17, 18, 21, 22
3D-footprint Homologues: 8k86_A, 8k8c_A, 2dgc_A, 2c9l_Z
Binding Motifs: 2e42_AB gTTGCGCAA
2e42_B gCAA
Binding Sites: 2e42_C
2e42_D
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.