Transcription Factor
| Accessions: | P02830 (JASPAR 2024) |
| Names: | Homeobox protein Hox-1.1, Homeobox protein Hox-A7, Homeobox protein M6-12, HXA7_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 229 |
| Pfam Domains: | 130-186 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSP 60 61 LYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYP 120 121 WMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 180 181 RMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEEE |
| Interface Residues: | 128, 130, 131, 132, 133, 134, 171, 172, 174, 175, 178, 179, 181, 182, 183, 186 |
| 3D-footprint Homologues: | 1puf_A, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 5zfz_A, 3cmy_A, 1ig7_A, 2lkx_A, 3d1n_M, 1jgg_B, 3lnq_A, 6m3d_C, 1zq3_P, 7q3o_C, 6es3_K, 2ld5_A, 1nk2_P, 8osb_E, 7psx_B, 5hod_A, 2hdd_A, 2r5y_A, 5jlw_D, 2hos_A, 8eml_B, 4xrs_G, 3a01_E, 1puf_B, 9b8u_A, 3rkq_B, 8ik5_C, 1b72_A, 5flv_I, 5zjt_E, 4cyc_A, 1e3o_C, 1le8_A, 7xrc_C, 1o4x_A, 1du0_A, 4qtr_D, 8bx1_A |
| Binding Motifs: | PH0054.1 sgmrtTAATTAatwagc PH0055.1 kkmkTAATTAmkggmm |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.