Transcription Factor

Accessions: 2p5l_D (3D-footprint 20241219), 2p5l_H (3D-footprint 20241219)
Names: Arginine hydroxamate resistance protein, Arginine repressor, ARGR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17893
Length: 64
Pfam Domains: 1-64 Arginine repressor, DNA binding domain
Sequence:
(in bold interface residues)
1 MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSY 60
61 KYSL
Interface Residues: 23, 38, 39, 40, 42, 43
3D-footprint Homologues: 6q2b_B, 5ui5_I
Binding Motifs: 2p5l_D aAtTCA
2p5l_DH AAtTCAnntTGAATT
Binding Sites: 2p5l_A
2p5l_B
Publications: Garnett J.A, Marincs F, Baumberg S, Stockley P.G, Phillips S.E. Structure and function of the arginine repressor-operator complex from Bacillus subtilis. Journal of molecular biology 379:284-98 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.