Transcription Factor
Accessions: | 2p5l_D (3D-footprint 20231221), 2p5l_H (3D-footprint 20231221) |
Names: | Arginine hydroxamate resistance protein, Arginine repressor, ARGR_BACSU |
Organisms: | Bacillus subtilis, strain 168 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P17893 |
Length: | 64 |
Pfam Domains: | 1-64 Arginine repressor, DNA binding domain |
Sequence: (in bold interface residues) | 1 MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSY 60 61 KYSL |
Interface Residues: | 1, 22, 23, 37, 38, 39, 40, 42, 43 |
3D-footprint Homologues: | 2p5l_D, 2o8k_A, 6q2b_B, 3lap_B, 5ui5_I |
Binding Motifs: | 2p5l_D aAtTCA 2p5l_DH AAtTCAnntTGAATT |
Binding Sites: | 2p5l_A 2p5l_B |
Publications: | Garnett J.A, Marincs F, Baumberg S, Stockley P.G, Phillips S.E. Structure and function of the arginine repressor-operator complex from Bacillus subtilis. Journal of molecular biology 379:284-98 (2008). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.