Transcription Factor

Accessions: 1a02_N (3D-footprint 20231221), 1s9k_C (3D-footprint 20231221)
Names: NF-ATc2, NF-ATp, NFAC2_HUMAN, NFAT pre-existing subunit, NFATc2, NUCLEAR FACTOR OF ACTIVATED T CELLS, Nuclear factor of activated T-cells, cytoplasmic 2, T-cell transcription factor NFAT1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q13469
Length: 280
Pfam Domains: 12-172 Rel homology domain (RHD)
191-277 IPT/TIG domain
Sequence:
(in bold interface residues)
1 WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQI 60
61 FIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGI 120
121 LKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELP 180
181 MVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNML 240
241 FVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
Interface Residues: 23, 25, 26, 28, 29, 32, 122, 139, 172, 173, 174, 203, 204, 236, 266, 267
3D-footprint Homologues: 1p7h_L, 1a66_A, 1imh_C, 2o61_A, 1nfk_A
Binding Motifs: 1a02_FJN GGAananwTGnyTCA
1s9k_CDE TGAAnAnnTGTGTAA
Binding Sites: 1a02_A
1a02_B
Publications: Chen L., Glover J. N. M., Hogan P. G., Rao A., Harrison S. C. Structure of the DNA-binding domains from NFAT, Fos and Jun bound specifically to DNA.. Nature 392:42-48 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.