Transcription Factor
| Accessions: | 4r4e_B (3D-footprint 20250804) |
| Names: | GLNR_BACSU, HTH-type transcriptional regulator GlnR |
| Organisms: | Bacillus subtilis, strain 168 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P37582 |
| Length: | 84 |
| Pfam Domains: | 14-49 MerR family regulatory protein 14-78 MerR HTH family regulatory protein |
| Sequence: (in bold interface residues) | 1 MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI 60 61 KHLIEQGVNMAGIKQILAKAEAEP |
| Interface Residues: | 21, 22, 26, 27, 29, 30, 33, 34, 46 |
| 3D-footprint Homologues: | 4uno_A, 6xh7_H, 4r24_B, 5d8c_A, 1r8d_B, 6xl5_H, 4r4e_B, 6jgx_B, 2vz4_A, 7tea_B, 6ldi_G, 2zhg_A, 7tec_A, 5c8e_C |
| Binding Motifs: | 4r4e_B tTntnAC |
| Binding Sites: | 4r4e_D 4r4e_E |
| Publications: | Schumacher M.A, Chinnam N.B, Cuthbert B, Tonthat N.K, Whitfill T. Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis. Genes & development 29:451-64 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.