Transcription Factor

Accessions: 4r4e_B (3D-footprint 20250804)
Names: GLNR_BACSU, HTH-type transcriptional regulator GlnR
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P37582
Length: 84
Pfam Domains: 14-49 MerR family regulatory protein
14-78 MerR HTH family regulatory protein
Sequence:
(in bold interface residues)
1 MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI 60
61 KHLIEQGVNMAGIKQILAKAEAEP
Interface Residues: 21, 22, 26, 27, 29, 30, 33, 34, 46
3D-footprint Homologues: 4uno_A, 6xh7_H, 4r24_B, 5d8c_A, 1r8d_B, 6xl5_H, 4r4e_B, 6jgx_B, 2vz4_A, 7tea_B, 6ldi_G, 2zhg_A, 7tec_A, 5c8e_C
Binding Motifs: 4r4e_B tTntnAC
Binding Sites: 4r4e_D
4r4e_E
Publications: Schumacher M.A, Chinnam N.B, Cuthbert B, Tonthat N.K, Whitfill T. Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis. Genes & development 29:451-64 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.