Transcription Factor

						

			
Accessions: 4r4e_B (3D-footprint 20231221)

			
Names: GLNR_BACSU, HTH-type transcriptional regulator GlnR
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P37582
Length: 84
Pfam Domains:     14-49 MerR family regulatory protein
    14-78 MerR HTH family regulatory protein
Sequence: 
(in bold interface residues)		   1 MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEI   60
  61 KHLIEQGVNMAGIKQILAKAEAEP
Interface Residues: 21, 22, 26, 27, 29, 30, 33, 34, 46
3D-footprint Homologues: 4uno_A, 4r24_B, 5d8c_A, 1r8d_B, 6xl5_H, 4r4e_B, 6jgx_B, 2vz4_A, 7tea_B, 6ldi_G, 2zhg_A, 7tec_A, 5c8e_C, 6xh7_H
Binding Motifs: 4r4e_B tTntnAC
Binding Sites: 4r4e_D
4r4e_E
			
Publications: Schumacher M.A, Chinnam N.B, Cuthbert B, Tonthat N.K, Whitfill T. Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis. Genes & development 29:451-64 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.