Transcription Factor

Accessions: 6j9a_A (3D-footprint 20260701)
Names: B3 domain-containing transcription repressor VAL1, Protein HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2, Protein VP1/ABI3-LIKE 1, VAL1_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8W4L5
Length: 106
Pfam Domains: 5-103 B3 DNA binding domain
Sequence:
(in bold interface residues)
1 IVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGREWTFQFRYWP 60
61 NNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAA
Interface Residues: 10, 12, 17, 18, 19, 21, 27, 28, 31, 57, 59, 60, 61, 62, 63, 64, 65, 66
3D-footprint Homologues: 6j9b_A, 6fas_B, 7et6_A, 6j9c_D, 6ycq_A, 8oj2_A, 2h7g_X
Binding Motifs: 6j9a_A CATGCa
Binding Sites: 6j9a_B
6j9a_C
Publications: Tao Z, Hu H, Luo X, Jia B, Du J, He Y. Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis. Nat Plants 5:424-435 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.