Transcription Factor
| Accessions: | UNCX_DBD (HumanTF 1.0), UNCX (HT-SELEX2 May2017) |
| Names: | Homeobox protein unc-4 homolog, Homeobox protein Uncx4.1, UNC4_HUMAN, UNCX, ENSG00000164853 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | A6NJT0 |
| Notes: | Ensembl ID: ENSG00000164853; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3b0, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0 |
| Length: | 117 |
| Pfam Domains: | 33-89 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVF 60 61 MREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPE |
| Interface Residues: | 33, 34, 35, 36, 74, 75, 77, 78, 81, 82, 84, 85, 86, 89 |
| 3D-footprint Homologues: | 1fjl_B, 3cmy_A, 8pmf_A, 1ig7_A, 5zfz_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 1zq3_P, 2lkx_A, 6m3d_C, 1jgg_B, 3lnq_A, 1nk2_P, 2ld5_A, 8osb_E, 7q3o_C, 5jlw_D, 3rkq_B, 8eml_B, 1b72_A, 6es3_K, 4xrs_G, 2hdd_A, 4cyc_A, 2r5y_A, 5flv_I, 2hos_A, 9b8u_A, 1puf_B, 8ik5_C, 7psx_B, 5hod_A, 1au7_A, 3a01_E, 7xrc_C, 4j19_B, 2xsd_C, 1e3o_C, 1o4x_A, 8g87_X, 1du0_A, 8bx1_A, 5zjt_E, 4qtr_D |
| Binding Motifs: | UNCX_DBD_1 ytaAtyyAATtar UNCX_DBD_2 yyAATTAr UNCX_2 kyaATtrg UNCX_methyl_1 mdcrttRr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.