Transcription Factor

Accessions: IRX3 (HT-SELEX2 May2017)
Names: ENSG00000177508, IRX3
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 192
Pfam Domains: 124-167 Homeobox domain
125-164 Homeobox KN domain
Sequence:
(in bold interface residues)
1 GAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAAQGYGAFLPYA 60
61 AELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTS 120
121 TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTD 180
181 EEGNAYGSEREE
Interface Residues: 110, 111, 112, 113, 114, 115, 118, 152, 153, 155, 156, 159, 160, 161, 163, 164, 166, 167
3D-footprint Homologues: 1mnm_C, 1puf_B, 3d1n_M, 1fjl_B, 2h1k_B, 2ld5_A, 5jlw_D, 7xrc_C, 1ig7_A, 1le8_B, 7psx_B, 4xrm_B, 2lkx_A, 1puf_A, 5zjt_E, 2hdd_A, 4xrs_G, 2r5y_A, 6fqp_B, 3rkq_B, 1nk2_P, 1b72_A, 5flv_I, 3a01_E, 2d5v_B, 1k61_B, 6fqq_E, 4cyc_A, 1o4x_A, 1du0_A, 3cmy_A, 2hos_A
Binding Motifs: IRX3_2 wACAyGawwwwtCrTGTw
IRX3_methyl_1 wACryrwwwwwwykCGTw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.