Transcription Factor

						

			
Accessions: 5yj3_C (3D-footprint 20231221)

			
Names: hKR3, Krueppel-related zinc finger protein 3, Telomere zinc finger-associated protein, TZAP_HUMAN, Zinc finger and BTB domain-containing protein 48, Zinc finger protein 855
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 70
Pfam Domains:      3-21 Zinc-finger of C2H2 type
     3-24 Zinc finger, C2H2 type
     3-24 C2H2 type zinc-finger (2 copies)
     4-24 C2H2-type zinc finger
    17-41 Zinc-finger double domain
    28-53 C2H2 type zinc-finger (2 copies)
    30-50 Zinc-finger of C2H2 type
    30-52 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 PHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDRVENYNP   60
  61 RQRKLRNLII
Interface Residues: 12, 13, 14, 15, 16, 17, 18, 19, 20, 40, 41, 42, 43, 44, 45, 46, 47, 48, 51, 63, 66
3D-footprint Homologues: 5ei9_F, 7w1m_H, 3uk3_C, 8cuc_F, 1tf3_A, 7y3l_A, 1g2f_F, 5yel_A, 4x9j_A, 2i13_A, 8gn3_A, 1llm_D, 7txc_E, 5kl3_A, 2wbs_A, 1ubd_C, 2jpa_A, 8h9h_G, 1mey_C, 6jnm_A, 5und_A, 2drp_D, 1f2i_J, 6a57_A, 5k5i_A, 2kmk_A, 8ssq_A, 6ml4_A, 2gli_A, 7n5w_A, 6blw_A, 5kkq_D, 2lt7_A, 8ssu_A, 1tf6_A, 6u9q_A, 4m9v_C, 6e94_A, 7ysf_A, 6wmi_A, 7eyi_G, 8gh6_A, 7y3m_I, 5yj3_D, 5v3j_F
Binding Motifs: 5yj3_CD tTAGGGtTAG
			
Publications: Zhao Y, Zhang G, He C, Mei Y, Shi Y, Li F. The 11th C2H2 zinc finger and an adjacent C-terminal arm are responsible for TZAP recognition of telomeric DNA. Cell Res 28:130-134 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.