Transcription Factor
Accessions: | 5yj3_C (3D-footprint 20231221) |
Names: | hKR3, Krueppel-related zinc finger protein 3, Telomere zinc finger-associated protein, TZAP_HUMAN, Zinc finger and BTB domain-containing protein 48, Zinc finger protein 855 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Length: | 70 |
Pfam Domains: | 3-21 Zinc-finger of C2H2 type 3-24 Zinc finger, C2H2 type 3-24 C2H2 type zinc-finger (2 copies) 4-24 C2H2-type zinc finger 17-41 Zinc-finger double domain 28-53 C2H2 type zinc-finger (2 copies) 30-50 Zinc-finger of C2H2 type 30-52 C2H2-type zinc finger 30-52 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 PHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDRVENYNP 60 61 RQRKLRNLII |
Interface Residues: | 12, 13, 14, 15, 16, 17, 18, 19, 20, 40, 41, 42, 43, 44, 45, 46, 47, 48, 51, 63, 66 |
3D-footprint Homologues: | 5ei9_F, 7w1m_H, 3uk3_C, 8cuc_F, 1tf3_A, 7y3l_A, 1g2f_F, 5yel_A, 4x9j_A, 2i13_A, 8gn3_A, 1llm_D, 7txc_E, 5kl3_A, 2wbs_A, 1ubd_C, 2jpa_A, 8h9h_G, 1mey_C, 6jnm_A, 5und_A, 2drp_D, 1f2i_J, 6a57_A, 5k5i_A, 2kmk_A, 8ssq_A, 6ml4_A, 2gli_A, 7n5w_A, 6blw_A, 5kkq_D, 2lt7_A, 8ssu_A, 1tf6_A, 6u9q_A, 4m9v_C, 6e94_A, 7ysf_A, 6wmi_A, 7eyi_G, 8gh6_A, 7y3m_I, 5yj3_D, 5v3j_F |
Binding Motifs: | 5yj3_CD tTAGGGtTAG |
Publications: | Zhao Y, Zhang G, He C, Mei Y, Shi Y, Li F. The 11th C2H2 zinc finger and an adjacent C-terminal arm are responsible for TZAP recognition of telomeric DNA. Cell Res 28:130-134 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.