Transcription Factor

						

			
Accessions: 3jxb_D (3D-footprint 20231221)

			
Names: Repressor protein C2, RPC2_BPP22
Organisms: Enterobacteria phage P22
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P69202
Length: 65
Pfam Domains:      3-59 Helix-turn-helix domain
     4-64 Helix-turn-helix domain
     7-61 Helix-turn-helix
    12-62 Cro/C1-type HTH DNA-binding domain
Sequence: 
(in bold interface residues)		   1 QLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDY   60
  61 LLKGD
Interface Residues: 18, 19, 28, 29, 30, 31, 33, 34, 37, 39, 40
3D-footprint Homologues: 8a0w_B, 2r1j_L, 6fix_D, 3zkc_A, 6yl2_A, 4jcy_A, 6w1a_A
Binding Motifs: 3jxb_CD TTAAGnnnnCTTAAATA
3jxb_D TTAAGnnnnnnnnnnTA
Binding Sites: 3jxb_A
3jxb_B
			
Publications: Watkins D, Mohan S, Koudelka G.B, Williams L.D. Sequence recognition of DNA by protein-induced conformational transitions. Journal of molecular biology 396:1145-64 (2010). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.