Transcription Factor
| Accessions: | Q4QPP9 (JASPAR 2024) |
| Names: | GH02096p, Maf-S, isoform A, Q4QPP9_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q4QPP9 |
| Length: | 132 |
| Pfam Domains: | 21-115 bZIP Maf transcription factor |
| Sequence: (in bold interface residues) | 1 MEAKRERKSSLAPLSPCPIPDITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLK 60 61 NRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKALLQFAIQ 120 121 NEIPIPSELEGC |
| Interface Residues: | 57, 61, 62, 64, 65, 68, 69 |
| 3D-footprint Homologues: | 7x5e_E, 2wt7_B, 7x5e_F, 4eot_A, 5vpe_D |
| Binding Motifs: | MA0530.1 rATGAckcdGCAmww MA0530.2 ATGAckcdGCAmww |
| Binding Sites: | MA0530.1.1 MA0530.1.10 MA0530.1.11 MA0530.1.12 MA0530.1.13 MA0530.1.14 MA0530.1.15 MA0530.1.16 MA0530.1.17 MA0530.1.18 MA0530.1.19 MA0530.1.2 MA0530.1.20 MA0530.1.3 MA0530.1.4 MA0530.1.5 MA0530.1.6 MA0530.1.7 MA0530.1.8 MA0530.1.9 MA0530.2.1 MA0530.2.10 MA0530.2.11 MA0530.2.12 MA0530.2.13 MA0530.2.14 MA0530.2.15 MA0530.2.16 MA0530.2.17 MA0530.2.18 MA0530.2.19 MA0530.2.2 MA0530.2.20 MA0530.2.3 MA0530.2.4 MA0530.2.5 MA0530.2.6 MA0530.2.7 MA0530.2.8 MA0530.2.9 |
| Publications: | Veraksa A, McGinnis N, Li X, Mohler J, McGinnis W. Cap 'n' collar B cooperates with a small Maf subunit to specify pharyngeal development and suppress deformed homeotic function in the Drosophila head. Development (Cambridge, England) 127:4023-37 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.