Transcription Factor
| Accessions: | 3qrf_G (3D-footprint 20250804) |
| Names: | Forkhead box protein P3, FOXP3_HUMAN, Scurfin |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9BZS1 |
| Length: | 82 |
| Pfam Domains: | 2-76 Fork head domain |
| Sequence: (in bold interface residues) | 1 MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF 60 61 VRVESEKGAVWTVDELEFRKKR |
| Interface Residues: | 25, 34, 36, 42, 44, 45, 47, 48, 49, 51, 52, 53, 55, 56, 65, 67 |
| 3D-footprint Homologues: | 8vfz_O, 7kt2_A, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 2a07_J, 7yzb_A, 7cby_C, 3co6_C, 7vou_C, 6ako_C, 2c6y_A, 7yze_A, 3g73_A, 6el8_A, 7yzg_A, 7tdw_A, 7yz7_A, 6nce_A, 2uzk_A, 7tdx_A, 3qrf_G, 8sro_B |
| Binding Motifs: | 3qrf_G GAAACA |
| Binding Sites: | 3qrf_D 3qrf_C |
| Publications: | Bandukwala H.S, Wu Y, Feuerer M, Chen Y, Barboza B, Ghosh S, Stroud J.C, Benoist C, Mathis D, Rao A, Chen L. Structure of a domain-swapped FOXP3 dimer on DNA and its function in regulatory T cells. Immunity 34:479-91 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.