Transcription Factor
| Accessions: | MAFF_HUMAN (HOCOMOCO 10), Q9ULX9 (JASPAR 2024) |
| Names: | MAFF_HUMAN, Transcription factor MafF, U-Maf, V-maf musculoaponeurotic fibrosarcoma oncogene homolog F |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9ULX9 |
| Length: | 164 |
| Pfam Domains: | 23-115 bZIP Maf transcription factor |
| Sequence: (in bold interface residues) | 1 MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK 60 61 NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS 120 121 VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS |
| Interface Residues: | 57, 61, 64, 65, 68, 69 |
| 3D-footprint Homologues: | 2wt7_B, 4eot_A, 7x5e_E |
| Binding Motifs: | MA0495.1 gctrasTCAGCAwwwwtt MAFF_HUMAN.H10MO.A|M01308 awwwwTGCTGAsTcaGCAwwwt MA0495.2 wwwtTGCTGAgTCAGCAawww MA0495.3 rwGTCAGCAtTTtwww MA0495.4 GTCAGCAtTTt |
| Binding Sites: | MA0495.1.1 MA0495.1.10 MA0495.1.11 MA0495.1.12 MA0495.1.13 MA0495.1.14 MA0495.1.15 MA0495.1.16 MA0495.1.17 MA0495.1.18 MA0495.1.19 MA0495.1.2 MA0495.1.20 MA0495.1.3 MA0495.1.4 MA0495.1.5 MA0495.1.6 MA0495.1.7 MA0495.1.8 MA0495.1.9 MA0495.2.1 MA0495.2.10 MA0495.2.11 MA0495.2.12 MA0495.2.13 MA0495.2.14 MA0495.2.15 MA0495.2.16 MA0495.2.17 MA0495.2.18 MA0495.2.19 MA0495.2.2 MA0495.2.20 MA0495.2.3 MA0495.2.4 MA0495.2.5 MA0495.2.6 MA0495.2.7 MA0495.2.8 MA0495.2.9 MA0495.3.1 MA0495.3.10 MA0495.3.11 / MA0495.3.5 MA0495.3.12 / MA0495.3.6 MA0495.3.13 MA0495.3.14 / MA0495.3.8 MA0495.3.15 / MA0495.3.9 MA0495.3.10 / MA0495.3.16 MA0495.3.17 MA0495.3.18 MA0495.3.11 / MA0495.3.19 MA0495.3.1 / MA0495.3.2 MA0495.3.20 MA0495.3.2 / MA0495.3.3 MA0495.3.4 MA0495.3.3 / MA0495.3.5 MA0495.3.6 MA0495.3.7 MA0495.3.4 / MA0495.3.8 MA0495.3.9 MA0495.3.12 MA0495.3.13 MA0495.3.14 MA0495.3.15 MA0495.3.16 MA0495.3.17 MA0495.3.18 MA0495.3.19 MA0495.3.20 MA0495.3.7 MA0495.4.1 MA0495.4.10 MA0495.4.11 MA0495.4.12 MA0495.4.13 MA0495.4.14 / MA0495.4.3 MA0495.4.15 MA0495.4.16 MA0495.4.17 MA0495.4.18 MA0495.4.19 MA0495.4.2 MA0495.4.20 MA0495.4.4 MA0495.4.5 MA0495.4.6 MA0495.4.7 MA0495.4.8 MA0495.4.9 |
| Publications: | Kataoka K., Noda M., Nishizawa M. Maf nuclear oncoprotein recognizes sequences related to an AP-1 site and forms heterodimers with both Fos and Jun. Mol. Cell. Biol. 14:700-712 (1994). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.