Transcription Factor

Accessions: Kr (FlyZincFinger 1.0 )
Names: CG3340
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 144
Pfam Domains: 9-31 C2H2-type zinc finger
9-19 C2H2-type zinc finger
9-31 Zinc finger, C2H2 type
24-48 Zinc-finger double domain
36-47 C2H2-type zinc finger
37-59 Zinc finger, C2H2 type
37-59 C2H2-type zinc finger
37-57 Zinc-finger of C2H2 type
51-75 Zinc-finger double domain
65-87 C2H2-type zinc finger
65-87 Zinc finger, C2H2 type
65-87 C2H2-type zinc finger
79-103 Zinc-finger double domain
92-114 C2H2-type zinc finger
93-115 Zinc finger, C2H2 type
93-112 Zinc-finger of C2H2 type
93-116 C2H2-type zinc finger
108-131 Zinc-finger double domain
120-136 C2H2-type zinc finger
121-139 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHT 60
61 GEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKP 120
121 FECERCHMKFRRRHHLMNHKCGIQ
Interface Residues: 19, 20, 21, 22, 23, 26, 37, 47, 48, 49, 50, 51, 53, 54, 56, 57, 58, 60, 75, 76, 77, 78, 79, 81, 82, 83, 85, 89, 90, 104, 105, 106, 107, 108, 109, 110, 111, 132, 133, 134, 135, 138
3D-footprint Homologues: 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 1tf3_A, 7w1m_H, 1tf6_A, 2gli_A, 5ei9_F, 5k5i_A, 5v3j_F, 2drp_D, 8h9h_G, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 3uk3_C, 4x9j_A, 8ssu_A, 1g2f_F, 5kkq_D, 5yj3_D, 1llm_D, 5kl3_A, 7txc_E, 6ml4_A, 8ssq_A, 1f2i_J, 6blw_A, 6e94_A, 5yel_A, 2jpa_A, 6u9q_A, 2wbs_A, 8gn3_A, 5k5l_F, 4m9v_C, 2lt7_A, 1yuj_A
Binding Motifs: Kr_NAR_FBgn0001325 crAAaGGGTTa
Kr_FlyReg_FBgn0001325 AAmGGGTtaw
Kr_SANGER_5_FBgn0001325 rArGGGTw
Kr_SOLEXA_FBgn0001325 styAMCCCtTtcsyy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.