Transcription Factor
Accessions: | Kr (FlyZincFinger 1.0 ) |
Names: | CG3340 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 144 |
Pfam Domains: | 9-19 C2H2-type zinc finger 9-31 Zinc finger, C2H2 type 9-31 C2H2-type zinc finger 24-48 Zinc-finger double domain 36-47 C2H2-type zinc finger 37-57 Zinc-finger of C2H2 type 37-59 Zinc finger, C2H2 type 37-59 C2H2-type zinc finger 51-75 Zinc-finger double domain 65-87 C2H2-type zinc finger 65-87 C2H2-type zinc finger 65-87 Zinc finger, C2H2 type 79-103 Zinc-finger double domain 92-114 C2H2-type zinc finger 93-112 Zinc-finger of C2H2 type 93-116 C2H2-type zinc finger 93-115 Zinc finger, C2H2 type 108-131 Zinc-finger double domain 120-136 C2H2-type zinc finger 121-139 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHT 60 61 GEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKP 120 121 FECERCHMKFRRRHHLMNHKCGIQ |
Interface Residues: | 19, 20, 21, 22, 23, 26, 37, 47, 48, 49, 50, 51, 53, 54, 56, 57, 58, 60, 75, 76, 77, 78, 79, 81, 82, 83, 85, 89, 90, 104, 105, 106, 107, 108, 109, 110, 111, 132, 133, 134, 135, 138 |
3D-footprint Homologues: | 7w1m_H, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 1tf6_A, 2gli_A, 5v3j_F, 5ei9_F, 2drp_D, 6wmi_A, 5k5i_A, 7eyi_G, 8h9h_G, 2i13_A, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 3uk3_C, 1llm_D, 8ssu_A, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 7txc_E, 5kl3_A, 1g2f_F, 5yj3_D, 8ssq_A, 6e94_A, 5yel_A, 2jpa_A, 5und_A, 5k5l_F, 8gn3_A, 2wbs_A, 6u9q_A, 4m9v_C, 2lt7_A, 1yuj_A |
Binding Motifs: | Kr_NAR_FBgn0001325 crAAaGGGTTa Kr_FlyReg_FBgn0001325 AAmGGGTtaw Kr_SANGER_5_FBgn0001325 rArGGGTw Kr_SOLEXA_FBgn0001325 styAMCCCtTtcsyy |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.