Transcription Factor
| Accessions: | 3dfv_C (3D-footprint 20231221), 3dfv_D (3D-footprint 20231221) |
| Names: | GATA-binding factor 3, GATA3_MOUSE, Trans-acting T-cell-specific transcription factor GATA-3 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P23772 |
| Length: | 56 |
| Pfam Domains: | 7-39 GATA zinc finger |
| Sequence: (in bold interface residues) | 1 RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR |
| Interface Residues: | 16, 17, 19, 29, 33, 34, 37, 54, 56 |
| 3D-footprint Homologues: | 1gat_A, 3dfx_B, 4gat_A, 3vd6_C |
| Binding Motifs: | 3dfv_CD TkATAannmTTAT 3dfv_D AGATAA |
| Binding Sites: | 3dfv_Y 3dfv_Z |
| Publications: | Bates D.L, Chen Y, Kim G, Guo L, Chen L. Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA. Journal of molecular biology 381:1292-306 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.