Transcription Factor

Accessions: 3dfv_C (3D-footprint 20241219), 3dfv_D (3D-footprint 20241219)
Names: GATA-binding factor 3, GATA3_MOUSE, Trans-acting T-cell-specific transcription factor GATA-3
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23772
Length: 56
Pfam Domains: 7-39 GATA zinc finger
Sequence:
(in bold interface residues)
1 RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR
Interface Residues: 38, 41, 42
3D-footprint Homologues: 7aud_E
Binding Motifs: 3dfv_CD TkATAannmTTAT
3dfv_D AGATAA
Binding Sites: 3dfv_Y
3dfv_Z
Publications: Bates D.L, Chen Y, Kim G, Guo L, Chen L. Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA. Journal of molecular biology 381:1292-306 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.