Transcription Factor

						

			
Accessions: 3mu6_A (3D-footprint 20231221), 3mu6_B (3D-footprint 20231221)

			
Names: MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02078
Length: 71
Pfam Domains:      9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence: 
(in bold interface residues)		   1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD   60
  61 MDKVLLKYTAY
Interface Residues: 2, 3, 14, 17, 18, 22, 56, 67
3D-footprint Homologues: 1n6j_A, 1c7u_A, 7x1n_C, 1hbx_A, 1mnm_A, 7yq3_E
Binding Motifs: 3mu6_AB CTAnnnnTAG
Binding Sites: 3mu6_E
3mu6_F
			
Publications: Jayathilaka N, Han A, Gaffney K.J, Dey R, Jarusiewicz J.A, Noridomi K, Philips M.A, Lei X, He J, Ye J, Gao T, Petasis N.A, Chen L. Inhibition of the function of class IIa HDACs by blocking their interaction with MEF2. Nucleic acids research 40:5378-88 (2012). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.