Transcription Factor
| Accessions: | 6o19_A (3D-footprint 20260701) |
| Names: | Transcription factor Pho7, YBCB_SCHPO |
| Organisms: | Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O13658 |
| Length: | 59 |
| Pfam Domains: | 13-49 Fungal Zn(2)-Cys(6) binuclear cluster domain |
| Sequence: (in bold interface residues) | 1 SGKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYK |
| Interface Residues: | 10, 21, 22, 23, 47, 49, 55, 58 |
| 3D-footprint Homologues: | 6o19_A, 2er8_C, 1pyi_A, 6gys_C, 1zme_D |
| Binding Motifs: | 6o19_A TCGGnnnnTAAA |
| Binding Sites: | 6o19_B 6o19_C |
| Publications: | Garg A, Goldgur Y, Sanchez AM, Schwer B, Shuman S. Structure of Fission Yeast Transcription Factor Pho7 Bound to pho1 Promoter DNA and Effect of Pho7 Mutations on DNA Binding and Phosphate Homeostasis. Mol Cell Biol : (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.