Transcription Factor

Accessions: 6o19_A (3D-footprint 20260701)
Names: Transcription factor Pho7, YBCB_SCHPO
Organisms: Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O13658
Length: 59
Pfam Domains: 13-49 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence:
(in bold interface residues)
1 SGKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYK
Interface Residues: 10, 21, 22, 23, 47, 49, 55, 58
3D-footprint Homologues: 6o19_A, 2er8_C, 1pyi_A, 6gys_C, 1zme_D
Binding Motifs: 6o19_A TCGGnnnnTAAA
Binding Sites: 6o19_B
6o19_C
Publications: Garg A, Goldgur Y, Sanchez AM, Schwer B, Shuman S. Structure of Fission Yeast Transcription Factor Pho7 Bound to pho1 Promoter DNA and Effect of Pho7 Mutations on DNA Binding and Phosphate Homeostasis. Mol Cell Biol : (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.