Transcription Factor

Accessions: 5bng_A (3D-footprint 20231221)
Names: Homeobox protein Meis2, Meis1-related protein 1, MEIS2_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O14770
Length: 59
Pfam Domains: 11-50 Homeobox KN domain
13-50 Homeobox domain
Sequence:
(in bold interface residues)
1 PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS
Interface Residues: 41, 42, 45, 46, 47, 49, 50
3D-footprint Homologues: 7q3o_C, 4j19_B, 1le8_A, 1au7_A, 5flv_I, 3cmy_A, 1k61_B, 6es3_K, 1puf_B, 8g87_X, 5hod_A, 3l1p_A, 6fqp_B, 4xrm_B, 2d5v_B, 5zfz_A, 3lnq_A, 1le8_B, 6fqq_E, 4xrs_G, 2lkx_A, 1fjl_B, 6a8r_A, 3rkq_B, 1mnm_C
Binding Motifs: 5bng_A TgACA
Binding Sites: 5bng_C
5bng_D
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.