Transcription Factor
Accessions: | 5bng_A (3D-footprint 20241219) |
Names: | Homeobox protein Meis2, Meis1-related protein 1, MEIS2_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O14770 |
Length: | 59 |
Pfam Domains: | 11-50 Homeobox KN domain 13-50 Homeobox domain |
Sequence: (in bold interface residues) | 1 PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS |
Interface Residues: | 38, 41, 42, 45, 46, 48, 49, 50 |
3D-footprint Homologues: | 8ik5_C, 7xrc_C, 8osb_E, 7q3o_C, 2d5v_B, 2lkx_A, 8bx1_A, 6es3_K, 8g87_X, 1zq3_P |
Binding Motifs: | 5bng_A TgACA |
Binding Sites: | 5bng_C 5bng_D |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.