Transcription Factor

Accessions: 4hn5_B (3D-footprint 20231221), 5e69_A (3D-footprint 20231221), 5e69_B (3D-footprint 20231221), 5e6a_A (3D-footprint 20231221), 5e6a_B (3D-footprint 20231221), 5e6b_B (3D-footprint 20231221)
Names: GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04150
Length: 73
Pfam Domains: 2-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60
61 YRKCLQAGMNLEA
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: 5e6b_AB CGnnnAATnC
4hn5_AB CCnGnnGC
5e69_A anaTT
5e69_AB CgnnnAAtnT
5e6a_A AATnC
5e6a_AB CAnnnAATnC
Binding Sites: 4hn5_C
4hn5_D
5e69_C
5e69_D
5e6a_C
5e6a_D
5e6b_C
5e6b_D
Publications: Hudson W.H, Youn C, Ortlund E.A. The structural basis of direct glucocorticoid-mediated transrepression. Nature structural & molecular biology 20:53-8 (2013). [Pubmed]

Hudson WH, Vera IMS, Nwachukwu JC, Weikum ER, Herbst AG, Yang Q, Bain DL, Nettles KW, Kojetin DJ, Ortlund EA. Cryptic glucocorticoid receptor-binding sites pervade genomic NF-κB response elements. Nat Commun 9:1337 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.