Transcription Factor
| Accessions: | Q9NXT0 (JASPAR 2024) |
| Names: | ZN586_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9NXT0 |
| Length: | 402 |
| Pfam Domains: | 15-55 KRAB box 140-160 Zinc-finger double domain 149-163 C2H2-type zinc finger 172-188 Zinc-finger double domain 177-201 C2H2-type zinc finger 178-200 Zinc finger, C2H2 type 178-200 C2H2-type zinc finger 193-217 Zinc-finger double domain 206-228 C2H2-type zinc finger 206-226 C2H2-type zinc finger 206-228 Zinc finger, C2H2 type 221-244 Zinc-finger double domain 233-256 C2H2-type zinc finger 234-256 C2H2-type zinc finger 234-256 Zinc finger, C2H2 type 249-272 Zinc-finger double domain 261-284 C2H2-type zinc finger 262-284 C2H2-type zinc finger 262-284 Zinc finger, C2H2 type 276-300 Zinc-finger double domain 289-312 C2H2-type zinc finger 290-312 Zinc finger, C2H2 type 290-312 C2H2-type zinc finger 305-328 Zinc-finger double domain 317-339 Zinc finger, C2H2 type 317-339 C2H2-type zinc finger 317-339 C2H2-type zinc finger 332-355 Zinc-finger double domain 344-367 C2H2-type zinc finger 345-367 Zinc finger, C2H2 type 345-367 C2H2-type zinc finger 360-384 Zinc-finger double domain 372-395 C2H2-type zinc finger 373-395 Zinc finger, C2H2 type 373-395 C2H2-type zinc finger 387-402 Zinc-finger double domain |
| Sequence: (in bold interface residues) | 1 MAAAAALRAPAQSSVTFEDVAVNFSLEEWSLLNEAQRCLYRDVMLETLTLISSLGCWHGG 60 61 EDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTGER 120 121 PYECSKYGKLFHQKPTLHIHERFHTGQKTYECSECGKSFHQSSSLLQRQTLHTRERPYEC 180 181 IECGKAFAEKSSLINHRKVHSGAKRYECNECGKSFAYTSSLIKHRRIHTGERPYECSECG 240 241 RSFAENSSLIKHLRVHTGERPYECVECGKSFRRSSSLLQHQRVHTRERPYECSECGKSFS 300 301 LRSNLIHHQRVHTGERHECGQCGKSFSRKSSLIIHLRVHTGERPYECSDCGKSFAENSSL 360 361 IKHLRVHTGERPYECIDCGKSFRHSSSFRRHQRVHTGMRPYK |
| Interface Residues: | 161, 163, 164, 167, 188, 189, 190, 191, 192, 194, 195, 197, 198, 199, 201, 217, 218, 219, 220, 223, 227, 234, 244, 245, 246, 247, 248, 250, 251, 254, 272, 273, 274, 275, 276, 278, 279, 300, 301, 302, 303, 304, 306, 307, 310, 327, 328, 329, 330, 331, 332, 334, 337, 355, 356, 357, 358, 359, 361, 362, 363, 366, 368, 382, 384, 385, 386, 387, 388, 389, 390, 391, 394 |
| 3D-footprint Homologues: | 5v3j_F, 2i13_A, 6wmi_A, 7w1m_H, 1tf6_A, 8ssq_A, 8ssu_A, 7ysf_A, 2lt7_A, 2jpa_A, 1ubd_C, 6ml4_A, 5kkq_D, 6u9q_A, 5ei9_F, 7txc_E, 5kl3_A, 5yel_A, 2kmk_A, 1tf3_A, 1llm_D, 6blw_A, 2wbs_A, 1mey_C, 2drp_D, 1f2i_J, 5k5i_A, 5und_A, 5yj3_D, 6e94_A, 2gli_A, 7eyi_G, 7y3l_A, 7n5w_A, 3uk3_C, 6jnm_A, 8cuc_F, 4x9j_A, 1g2f_F, 5k5l_F, 8h9h_G, 7y3m_I, 6a57_A, 8gn3_A, 4m9v_C |
| Binding Motifs: | UN0638.1 wtkTGCTAATGCwrCarg UN0638.2 TGCTAATGCwrCa |
| Binding Sites: | UN0638.1.1 / UN0638.1.3 UN0638.1.10 / UN0638.1.14 UN0638.1.11 / UN0638.1.16 UN0638.1.12 / UN0638.1.20 UN0638.1.13 UN0638.1.14 UN0638.1.15 UN0638.1.16 UN0638.1.17 UN0638.1.18 UN0638.1.19 UN0638.1.2 / UN0638.1.4 UN0638.1.20 UN0638.1.3 / UN0638.1.5 UN0638.1.4 UN0638.1.5 / UN0638.1.9 UN0638.1.10 / UN0638.1.6 UN0638.1.11 / UN0638.1.7 UN0638.1.12 / UN0638.1.8 UN0638.1.13 / UN0638.1.9 UN0638.2.1 UN0638.2.8 UN0638.2.10 / UN0638.2.3 UN0638.2.11 UN0638.2.12 UN0638.2.5 UN0638.2.6 / UN0638.2.7 UN0638.1.1 UN0638.1.15 UN0638.1.17 UN0638.1.18 UN0638.1.19 UN0638.1.2 UN0638.1.6 UN0638.1.7 UN0638.1.8 UN0638.2.13 / UN0638.2.18 UN0638.2.14 UN0638.2.15 UN0638.2.16 UN0638.2.17 UN0638.2.19 UN0638.2.2 UN0638.2.20 UN0638.2.4 UN0638.2.9 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.