Transcription Factor

Accessions: E2F3_DBD (HumanTF 1.0)
Names: E2F-3, E2F3, E2F3_HUMAN, Transcription factor E2F3
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O00716
Notes: Ensembl ID: ENSG00000112242; DNA-binding domain sequence; TF family: E2F; Clone source: Megaman
Length: 111
Pfam Domains: 26-91 E2F/DP family winged-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MAGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLK 60
61 VQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEV
Interface Residues: 26, 62, 63, 64, 65, 67
3D-footprint Homologues: 4yo2_A, 1cf7_A, 1cf7_B
Binding Motifs: E2F3_DBD_1 aAAAAkGGCGCCAAAAtk
E2F3_DBD_2 aAAAAkGGCGCCawWTTt
E2F3_DBD_3 adTTTTGGCGCCAAAAct
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.