Transcription Factor

Accessions: 5szx_A (3D-footprint 20231221), 5szx_B (3D-footprint 20231221)
Names: BZLF1_EBVB9, EB1, Trans-activator protein BZLF1, Zebra, Zta transcription factor
Organisms: Epstein-Barr virus (strain B95-8) (HHV-4), Human herpesvirus 4
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03206
Length: 62
Pfam Domains: 2-55 bZIP transcription factor
Sequence:
(in bold interface residues)
1 LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRT 60
61 PD
Interface Residues: 5, 8, 9, 11, 12, 15, 16
3D-footprint Homologues: 6mg1_B, 1nwq_C, 2c9l_Z
Binding Motifs: 5szx_AB tTGCTCA
Binding Sites: 5szx_C
5szx_D
Publications: Hong S, Wang D, Horton JR, Zhang X, Speck SH, Blumenthal RM, Cheng X. Methyl-dependent and spatial-specific DNA recognition by the orthologous transcription factors human AP-1 and Epstein-Barr virus Zta. Nucleic Acids Res 45:2503-2515 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.