Transcription Factor
| Accessions: | 5wc9_B (3D-footprint 20260701) |
| Names: | GHF-1, Growth hormone factor 1, PIT-1, PIT1_HUMAN, Pituitary-specific positive transcription factor 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P28069 |
| Length: | 133 |
| Pfam Domains: | 2-74 Pou domain - N-terminal to homeobox domain 77-131 Homeobox domain |
| Sequence: (in bold interface residues) | 1 DSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNAC 60 61 KLKAILSKWLEEAEQVRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRV 120 121 WFCNRRQREKRVK |
| Interface Residues: | 26, 42, 43, 44, 45, 47, 48, 50, 51, 54, 56, 58, 75, 76, 78, 116, 117, 119, 120, 123, 124, 126, 127, 128, 131 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 8bx1_A, 1o4x_A, 7xrc_C, 8g87_X, 1e3o_C, 1au7_A, 2xsd_C, 2d5v_B, 8ity_V, 1nk2_P, 6m3d_C, 9b8u_A, 8ejp_B, 1b72_A, 4xrs_G, 1ig7_A, 5zfz_A, 3rkq_B, 2lkx_A, 8eml_B, 5flv_I, 3cmy_A, 8osb_E, 2hdd_A, 1jgg_B, 2r5y_A, 5hod_A, 8pmf_A, 2hos_A, 6a8r_A, 8ik5_C, 1fjl_B, 3lnq_A, 2ld5_A, 5jlw_D, 1le8_A, 7q3o_C, 6es3_K, 3a01_E, 1du0_A, 5zjt_E, 4cyc_A, 1puf_A, 7psx_B, 4qtr_D, 1zq3_P |
| Binding Motifs: | 5wc9_AB ATTCATTCATTCA |
| Binding Sites: | 5wc9_C 5wc9_D |
| Publications: | Agarwal S, Cho TY. Biochemical and structural characterization of a novel cooperative binding mode by Pit-1 with CATT repeats in the macrophage migration inhibitory factor promoter. Nucleic Acids Res : (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.