Transcription Factor
| Accessions: | HY5 (Athamap 20091028), O24646 (JASPAR 2024), T25436 (AthalianaCistrome v4_May2016), HY5 (EEADannot 2025-01-07) |
| Names: | AtbZIP56, bZIP transcription factor 56, HY5, Protein LONG HYPOCOTYL 5, TED5, Transcription factor HY5, HY5_ARATH, AT5G11260, T25436;, O24646 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3, EEADannot 2025-01-07 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 4 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), family:bZIP |
| Length: | 168 |
| Pfam Domains: | 86-146 bZIP transcription factor 87-140 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES 60 61 GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV 120 121 KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL |
| Interface Residues: | 98, 99, 101, 102, 105, 106 |
| 3D-footprint Homologues: | 2dgc_A, 7x5e_F |
| Binding Motifs: | HY5 CCACGTGkCAT MA0551.1 wwtGmCACGTGkCaww M0189 dwtGaTGACGTSgcm MA0551.2 tGmCACGTGkCa EEAD0166 TGACGT |
| Binding Sites: | HY5_1 HY5_2 |
| Publications: | Chattopadhyay S., Ang L.-H., Puente P., Deng X.-W., Wei N. Arabidopsis bZIP protein HY5 directly interacts with light-responsive promoters in mediating light control of gene expression.. Plant Cell 10:673-683 (1998). [Pubmed] Cluis CP, Mouchel CF, Hardtke CS. 2004. The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways. Plant J. 38:332-47. [Pubmed] Song Y. H., Yoo C. M., Hong A. P., Kim S. H., Jeong H. J., Shin S. Y., Kim H. J., Yun D. J., Lim C. O., Bahk J. D., Lee S. Y., Nagao R. T., Key J. L., Hong J. C. DNA-binding study identifies C-box and hybrid C/G-box or C/A-box motifs as high-affinity binding sites for STF1 and LONG HYPOCOTYL5 proteins.. Plant Physiol. 146:1862-1877 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.