Transcription Factor
| Accessions: | ZNF12 (HT-SELEX2 May2017) |
| Names: | ENSG00000164631, ZNF12 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 447 |
| Pfam Domains: | 5-28 Zinc-finger double domain 18-41 C2H2-type zinc finger 19-41 Zinc finger, C2H2 type 37-56 Zinc-finger double domain 46-57 C2H2-type zinc finger 47-69 C2H2-type zinc finger 47-69 Zinc finger, C2H2 type 62-85 Zinc-finger double domain 75-97 C2H2-type zinc finger 75-97 Zinc finger, C2H2 type 90-112 Zinc-finger double domain 102-126 C2H2-type zinc finger 103-125 C2H2-type zinc finger 103-125 Zinc finger, C2H2 type 117-141 Zinc-finger double domain 131-153 Zinc finger, C2H2 type 131-153 C2H2-type zinc finger 131-151 C2H2-type zinc finger 145-168 Zinc-finger double domain 158-181 C2H2-type zinc finger 159-181 Zinc finger, C2H2 type 159-181 C2H2-type zinc finger 174-197 Zinc-finger double domain 186-209 C2H2-type zinc finger 187-209 Zinc finger, C2H2 type 187-209 C2H2-type zinc finger 202-225 Zinc-finger double domain 214-237 C2H2-type zinc finger 215-237 Zinc finger, C2H2 type 215-237 C2H2-type zinc finger 229-253 Zinc-finger double domain 242-253 C2H2-type zinc finger 260-281 Zinc-finger double domain 270-280 C2H2-type zinc finger 271-293 Zinc finger, C2H2 type 288-309 Zinc-finger double domain 303-321 Zinc finger, C2H2 type 314-336 Zinc-finger double domain 326-349 C2H2-type zinc finger 327-349 C2H2-type zinc finger 327-349 Zinc finger, C2H2 type 341-365 Zinc-finger double domain 355-377 Zinc finger, C2H2 type 370-394 Zinc-finger double domain 383-405 Zinc finger, C2H2 type 383-405 C2H2-type zinc finger 383-396 C2H2-type zinc finger 398-422 Zinc-finger double domain 410-434 C2H2-type zinc finger 411-433 Zinc finger, C2H2 type 411-433 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 LQMSDLTVHQTSHMEMKPYECSECGKSFCKKSKFIIHQRTHTGEKPYECNQCGKSFCQKG 60 61 TLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQ 120 121 HQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRKSTLTTHLRT 180 181 HTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMRHQRVHTGE 240 241 KPYECNECGKLFSQLSYPTIHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHKGEKPYE 300 301 YYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHTGEKAYECYEC 360 361 GKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYECTECGKKF 420 421 YHKSAFNSHQRIHRRGNMNVIDVGRLL |
| Interface Residues: | 4, 8, 29, 30, 32, 33, 36, 47, 58, 59, 60, 61, 64, 85, 86, 87, 88, 89, 92, 95, 113, 114, 115, 116, 117, 119, 120, 122, 123, 125, 126, 141, 142, 143, 144, 145, 146, 147, 148, 149, 169, 170, 171, 172, 173, 174, 175, 176, 177, 179, 198, 199, 200, 201, 204, 208, 210, 224, 226, 227, 228, 229, 232, 236, 242, 244, 253, 254, 255, 256, 257, 260, 280, 281, 282, 284, 285, 288, 292, 309, 310, 312, 313, 316, 338, 340, 341, 343, 344, 366, 367, 368, 369, 372, 394, 395, 396, 397, 400, 422, 424, 425, 428 |
| 3D-footprint Homologues: | 7w1m_H, 7y3l_A, 8cuc_F, 5k5i_A, 2gli_A, 1tf6_A, 5ei9_F, 8ssq_A, 5yel_A, 2kmk_A, 8ssu_A, 5k5l_F, 7txc_E, 6jnm_A, 5v3j_F, 6a57_A, 3uk3_C, 6blw_A, 6ml4_A, 6u9q_A, 2jpa_A, 6dta_B, 2drp_D, 1g2f_F, 4m9v_C, 7n5w_A, 1tf3_A, 8gn3_A, 1f2i_J, 8h9h_G, 7y3m_I, 6vpc_F, 7ysf_A, 5kkq_D, 5kl3_A, 2lt7_A, 6e94_A, 1ubd_C, 4x9j_A, 2wbs_A, 1llm_D, 5yj3_D |
| Binding Motifs: | ZNF12_2 GGksmTryTTGTTAymGCata ZNF12_methyl_1 GGkGmTrCTCGTTAYAGCryr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.