Transcription Factor

Accessions: ZNF12 (HT-SELEX2 May2017)
Names: ENSG00000164631, ZNF12
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 447
Pfam Domains: 5-28 Zinc-finger double domain
18-41 C2H2-type zinc finger
19-41 Zinc finger, C2H2 type
37-56 Zinc-finger double domain
46-57 C2H2-type zinc finger
47-69 C2H2-type zinc finger
47-69 Zinc finger, C2H2 type
62-85 Zinc-finger double domain
75-97 C2H2-type zinc finger
75-97 Zinc finger, C2H2 type
90-112 Zinc-finger double domain
102-126 C2H2-type zinc finger
103-125 C2H2-type zinc finger
103-125 Zinc finger, C2H2 type
117-141 Zinc-finger double domain
131-153 Zinc finger, C2H2 type
131-153 C2H2-type zinc finger
131-151 C2H2-type zinc finger
145-168 Zinc-finger double domain
158-181 C2H2-type zinc finger
159-181 Zinc finger, C2H2 type
159-181 C2H2-type zinc finger
174-197 Zinc-finger double domain
186-209 C2H2-type zinc finger
187-209 Zinc finger, C2H2 type
187-209 C2H2-type zinc finger
202-225 Zinc-finger double domain
214-237 C2H2-type zinc finger
215-237 Zinc finger, C2H2 type
215-237 C2H2-type zinc finger
229-253 Zinc-finger double domain
242-253 C2H2-type zinc finger
260-281 Zinc-finger double domain
270-280 C2H2-type zinc finger
271-293 Zinc finger, C2H2 type
288-309 Zinc-finger double domain
303-321 Zinc finger, C2H2 type
314-336 Zinc-finger double domain
326-349 C2H2-type zinc finger
327-349 C2H2-type zinc finger
327-349 Zinc finger, C2H2 type
341-365 Zinc-finger double domain
355-377 Zinc finger, C2H2 type
370-394 Zinc-finger double domain
383-405 Zinc finger, C2H2 type
383-405 C2H2-type zinc finger
383-396 C2H2-type zinc finger
398-422 Zinc-finger double domain
410-434 C2H2-type zinc finger
411-433 Zinc finger, C2H2 type
411-433 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 LQMSDLTVHQTSHMEMKPYECSECGKSFCKKSKFIIHQRTHTGEKPYECNQCGKSFCQKG 60
61 TLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSGEKPYECSYCGKSFCQKTHLTQ 120
121 HQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCSECGKCFCRKSTLTTHLRT 180
181 HTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMRHQRVHTGE 240
241 KPYECNECGKLFSQLSYPTIHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHKGEKPYE 300
301 YYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQNSALNRHQRTHTGEKAYECYEC 360
361 GKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYECTECGKKF 420
421 YHKSAFNSHQRIHRRGNMNVIDVGRLL
Interface Residues: 4, 8, 29, 30, 32, 33, 36, 47, 58, 59, 60, 61, 64, 85, 86, 87, 88, 89, 92, 95, 113, 114, 115, 116, 117, 119, 120, 122, 123, 125, 126, 141, 142, 143, 144, 145, 146, 147, 148, 149, 169, 170, 171, 172, 173, 174, 175, 176, 177, 179, 198, 199, 200, 201, 204, 208, 210, 224, 226, 227, 228, 229, 232, 236, 242, 244, 253, 254, 255, 256, 257, 260, 280, 281, 282, 284, 285, 288, 292, 309, 310, 312, 313, 316, 338, 340, 341, 343, 344, 366, 367, 368, 369, 372, 394, 395, 396, 397, 400, 422, 424, 425, 428
3D-footprint Homologues: 7w1m_H, 7y3l_A, 8cuc_F, 5k5i_A, 2gli_A, 1tf6_A, 5ei9_F, 8ssq_A, 5yel_A, 2kmk_A, 8ssu_A, 5k5l_F, 7txc_E, 6jnm_A, 5v3j_F, 6a57_A, 3uk3_C, 6blw_A, 6ml4_A, 6u9q_A, 2jpa_A, 6dta_B, 2drp_D, 1g2f_F, 4m9v_C, 7n5w_A, 1tf3_A, 8gn3_A, 1f2i_J, 8h9h_G, 7y3m_I, 6vpc_F, 7ysf_A, 5kkq_D, 5kl3_A, 2lt7_A, 6e94_A, 1ubd_C, 4x9j_A, 2wbs_A, 1llm_D, 5yj3_D
Binding Motifs: ZNF12_2 GGksmTryTTGTTAymGCata
ZNF12_methyl_1 GGkGmTrCTCGTTAYAGCryr
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.