Transcription Factor
Accessions: | 1b01_A (3D-footprint 20231221), 1b01_B (3D-footprint 20231221), 1ea4_D (3D-footprint 20231221), 1ea4_K (3D-footprint 20231221) |
Names: | COPG_STRAG, Protein CopG, Protein RepA, TRANSCRIPTIONAL REPRESSOR COPG |
Organisms: | Streptococcus agalactiae |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P13920 |
Length: | 43 |
Pfam Domains: | 4-41 Ribbon-helix-helix protein, copG family |
Sequence: (in bold interface residues) | 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ |
Interface Residues: | 4, 6, 8, 17, 27, 28, 29, 30, 32, 33 |
3D-footprint Homologues: | 1b01_B, 6ido_B |
Binding Motifs: | 1b01_AB cgTGCA 1b01_B GTGCACG 1ea4_DEFG GtTGCAnnnnGTGCAAG 1ea4_HKL yGCAtnnnGTCCA 1ea4_K TGCA |
Binding Sites: | 1b01_E 1b01_F 1ea4_U 1ea4_V |
Publications: | Gomis-Rüth F.X, Solá M, Acebo P, Párraga A, Guasch A, Eritja R, González A, Espinosa M, del Solar G, Coll M. The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator. The EMBO journal 17:7404-15 (1998). [Pubmed] Costa M, Solà M, del Solar G, Eritja R, Hernández-Arriaga A.M, Espinosa M, Gomis-Rüth F.X, Coll M. Plasmid transcriptional repressor CopG oligomerises to render helical superstructures unbound and in complexes with oligonucleotides. Journal of molecular biology 310:403-17 (2001). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.