Transcription Factor

Accessions: 5ego_B (3D-footprint 20231221)
Names: Homeobox protein Hox-B13, HXB13_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q92826
Length: 63
Pfam Domains: 1-57 Homeobox domain
Sequence:
(in bold interface residues)
1 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA 60
61 KVK
Interface Residues: 1, 2, 3, 4, 12, 28, 30, 42, 43, 45, 46, 49, 50, 53, 54, 57
3D-footprint Homologues: 1fjl_B, 5zfz_A, 1ig7_A, 2h1k_B, 1puf_A, 3cmy_A, 6a8r_A, 1nk2_P, 1zq3_P, 2lkx_A, 6es3_K, 2ld5_A, 7q3o_C, 3lnq_A, 2hos_A, 4xrs_G, 1b72_A, 3rkq_B, 5flv_I, 3a01_E, 7psx_B, 5zjt_E, 4cyc_A, 1jgg_B, 2hdd_A, 2r5y_A, 6m3d_C, 1au7_A, 5jlw_D, 6vz3_A, 2xsd_C, 1le8_A, 1e3o_C, 7xrc_C, 1o4x_A, 6fqp_B, 1le8_B, 1du0_A, 6fqq_E, 5hod_A, 1mnm_C, 4qtr_D, 1puf_B, 1k61_B
Binding Motifs: 5ego_B tnnTAaa
5ego_AB TGACAgnTTTAnna
Binding Sites: 5ego_D
5ego_E
Publications: Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.