Transcription Factor

Accessions: CEBPG_full (HumanTF 1.0), CEBPG_TF1 (HumanTF2 1.0)
Names: C/EBP gamma, CCAAT/enhancer-binding protein gamma, CEBPG, CEBPG_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P53567
Notes: Ensembl ID: ENSG00000153879; Full protein sequence; TF family: bZIP; Clone source: hORFeome, Ensembl ID: ENSG00000153879; Construct type: TF1(SBP); TF family: bZIP; Clone source: Jolma et al. 2013
Length: 151
Pfam Domains: 62-114 Basic region leucine zipper
65-120 bZIP transcription factor
Sequence:
(in bold interface residues)
1 MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR 60
61 NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD 120
121 LFLEHAHNLADNVQSISTENTTADGDNAGQ*
Interface Residues: 68, 69, 72, 73, 75, 76, 79, 80
3D-footprint Homologues: 2wt7_A, 6mg1_B, 1nwq_C, 2c9l_Z
Binding Motifs: CEBPG_full rTTrCGCAAy
CEBPG_ATF4 rgATGAYGCAAT
CEBPG_CREB3L1 tGCcACGCAAym
CEBPG_ELF1 TkrcghmAtwsMGGAAGt
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.