Transcription Factor
Accessions: | 1ynw_B (3D-footprint 20241219) |
Names: | Nuclear receptor subfamily 2 group B member 1, Retinoic acid receptor RXR-alpha, Retinoid X receptor alpha, RXRA_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P19793 |
Length: | 73 |
Pfam Domains: | 1-69 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 ICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQ 60 61 KCLAMGMKREAVQ |
Interface Residues: | 11, 13, 20, 23, 24, 27, 28, 52 |
3D-footprint Homologues: | 7wnh_D, 6l6q_B, 3g9m_B, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A |
Binding Motifs: | 1ynw_AB TGACCnnnnTGnCC 1ynw_B TGaCc |
Binding Sites: | 1ynw_C 1ynw_D |
Publications: | Shaffer P.L, Gewirth D.T. Structural analysis of RXR-VDR interactions on DR3 DNA. The Journal of steroid biochemistry and molecular biology 89-90:215-9 (2004). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.