Transcription Factor

Accessions: 2d45_A (3D-footprint 20260701), 2d45_C (3D-footprint 20260701)
Names: MECI_STAAN, Methicillin resistance regulatory protein mecI
Organisms: Staphylococcus aureus, strain N315
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P68261
Length: 117
Pfam Domains: 4-117 Penicillinase repressor
4-60 MarR family
Sequence:
(in bold interface residues)
1 TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDN 60
61 KIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
Interface Residues: 23, 39, 40, 42, 43, 44, 46, 47, 51, 63, 65
3D-footprint Homologues: 2p7c_B, 1xsd_A, 1sax_A
Binding Motifs: 2d45_AB TanTACATATGTA
2d45_CD ACAnnTGTAgTA
Publications: Safo M.K, Ko T.P, Musayev F.N, Zhao Q, Wang A.H, Archer G.L. Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec. Acta crystallographica. Section F, Structural biology and crystallization communications 62:320-4 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.