Transcription Factor

Accessions: CDX1_DBD (HumanTF 1.0), CDX1 (HT-SELEX2 May2017)
Names: Caudal-type homeobox protein 1, CDX1, CDX1_HUMAN, Homeobox protein CDX-1, ENSG00000113722
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P47902
Notes: Ensembl ID: ENSG00000113722; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 250
Pfam Domains: 12-145 Caudal like protein activation region
155-210 Homeobox domain
Sequence:
(in bold interface residues)
1 YVGYVLDKDSPVYPGPARPASLGLGPANYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAW 60
61 GAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGT 120
121 PSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITI 180
181 RRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLG 240
241 GLCPSNTSLL
Interface Residues: 154, 155, 156, 157, 195, 196, 198, 199, 202, 203, 206, 207, 210
3D-footprint Homologues: 1puf_A, 3lnq_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 7q3o_C, 6es3_K, 2ld5_A, 1ig7_A, 5zjt_E, 3a01_E, 2h1k_B, 7psx_B, 6a8r_A, 3cmy_A, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 1fjl_B, 5zfz_A, 4cyc_A, 6m3d_C, 5flv_I, 1e3o_C, 1au7_A, 7xrc_C, 2xsd_C, 1le8_A, 4qtr_D, 1le8_B, 1du0_A, 5hod_A, 4xrm_B, 1mnm_C, 1puf_B, 1k61_B, 3d1n_M, 1b72_A, 3l1p_A, 1o4x_A, 8g87_X
Binding Motifs: CDX1_DBD gymATAAAa
CDX1_2 gGYmATAAAac
CDX1_methyl_1 kGTCGTAAAwy
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.