Transcription Factor
| Accessions: | Q9LZP8 (JASPAR 2024), T11942 (AthalianaCistrome v4_May2016), AtbZIP53 (EEADannot 2026-03-04) |
| Names: | AtbZIP53, bZIP transcription factor 53, BZP53_ARATH, AT3G62420, bZIP53, T11942;, Q9LZP8;BZP53_ARATH;AT3G62420.1 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2, EEADannot 2026-03-04 3 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 3 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:bZIP, family:Basic leucine zipper factors (bZIP) bZIP |
| Length: | 146 |
| Pfam Domains: | 22-72 Basic region leucine zipper 25-83 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 MGSLQMQTSPESDNDPRYATVTDERKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKN 60 61 DNAKITEQVDEASKKYIEMESKNNVLRAQASELTDRLRSLNSVLEMVEEISGQALDIPEI 120 121 PESMQNPWQMPCPMQPIRASADMFDC |
| Interface Residues: | 25, 29, 32, 33, 34, 36, 37, 40, 41 |
| 3D-footprint Homologues: | 4a12_B, 7x5e_E, 1gd2_G, 1dh3_C |
| Binding Motifs: | M0196 / MA1341.1 dwwGmTGACGTGGCa M0188 dwwGmTGACGTGKCa MA1341.2 wGmTGACGTGGCa EEAD0100 gwsACGTGGCA EEAD0101 tGmTGACGTGkmm EEAD0126 tGmCACGTsd EEAD0127 cyrmgTCAkCa EEAD0128 kMCACGTCAkc EEAD0129 kmCACGTGkCa EEAD0130 sACGTGKCa |
| Binding Sites: | MA1341.1.1 MA1341.1.18 MA1341.1.15 MA1341.1.12 / MA1341.1.17 MA1341.1.13 MA1341.1.19 MA1341.1.14 MA1341.1.20 MA1341.1.3 MA1341.1.4 MA1341.1.6 MA1341.1.2 / MA1341.1.5 MA1341.1.8 MA1341.1.7 MA1341.1.9 MA1341.1.16 MA1341.1.11 MA1341.1.10 MA1341.2.13 MA1341.2.14 MA1341.2.12 MA1341.2.17 MA1341.2.11 MA1341.2.20 MA1341.2.19 MA1341.2.16 MA1341.2.18 MA1341.2.1 MA1341.2.15 MA1341.2.3 MA1341.2.6 MA1341.2.8 MA1341.2.4 MA1341.2.2 / MA1341.2.5 MA1341.2.7 MA1341.2.9 MA1341.2.10 |
| Publications: | Martinez-Garcia J. F., Moyano E., Alcocer M. J. C., Martin C. Two bZIP proteins from Antirrhinum flowers preferentially bind a hybrid C-box/G-box motif and help to define a new sub-family of bZIP transcription factors.. Plant J. 13:489-505 (1998). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.