Transcription Factor
| Accessions: | B2RUK9 (JASPAR 2024) |
| Names: | B2RUK9_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | B2RUK9 |
| Length: | 458 |
| Pfam Domains: | 3-42 KRAB box 98-114 Zinc-finger double domain 105-128 C2H2-type zinc finger 106-128 Zinc finger, C2H2 type 121-145 Zinc-finger double domain 133-149 C2H2-type zinc finger 134-149 C2H2-type zinc finger 134-149 Zinc finger, C2H2 type 153-173 Zinc-finger double domain 161-180 C2H2-type zinc finger 162-184 C2H2-type zinc finger 162-184 Zinc finger, C2H2 type 177-199 Zinc-finger double domain 190-212 Zinc finger, C2H2 type 239-257 Zinc-finger double domain 245-268 C2H2-type zinc finger 246-268 Zinc finger, C2H2 type 261-285 Zinc-finger double domain 274-296 Zinc finger, C2H2 type 274-296 C2H2-type zinc finger 289-311 Zinc-finger double domain 301-325 C2H2-type zinc finger 302-324 Zinc finger, C2H2 type 302-324 C2H2-type zinc finger 316-341 Zinc-finger double domain 329-349 C2H2-type zinc finger 330-352 Zinc finger, C2H2 type 330-352 C2H2-type zinc finger 344-368 Zinc-finger double domain 357-380 C2H2-type zinc finger 358-380 C2H2-type zinc finger 358-380 Zinc finger, C2H2 type 372-397 Zinc-finger double domain 386-408 C2H2-type zinc finger 386-408 Zinc finger, C2H2 type 402-425 Zinc-finger double domain 413-436 C2H2-type zinc finger 414-436 C2H2-type zinc finger 414-436 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MLSFWDVAIDFSPEEWDCLEPAQWDLYRNVMLENFSHLVFLGLAVSKPFLVTFLEQRQGP 60 61 WDMKRQGMATVYPGIKPNDPNNFSKLTNCKSLLITQRRNHIGEKPYKCGECGKALSSHKT 120 121 LSIHQRLHTGDKPYKCEECHKAFSTRSSLFIYMKNHTDEKIYKCEDCGRTFYYLSMLKQH 180 181 QRIHSGEKPYKCEECGKCFGFPSFLKQHQNIHCRKNAYTYEDCVKRLSPPLPLQDNEQIH 240 241 TEEKPYKCGECYKAFSYHSAFRIHKTVHTGENPYKCEECGKCFSSSSYLKRHQTLHSEDK 300 301 PYKCEDCGRCFCSSSSLRRHQKFHSEGNPYKCEKCDKRFSCSASLQEHQTIHTGEKPYTC 360 361 ENCHKAFRYRSSLRKHKTVHTREKSYNCKKCPRAFSSYSCFVRHQAIHSEDNPHKCVECG 420 421 KAFVNVYSLTRHMTVHAGEKSYKGLKTLILLQSLKDIK |
| Interface Residues: | 97, 99, 100, 116, 117, 118, 119, 120, 123, 127, 144, 145, 146, 147, 148, 150, 151, 155, 172, 173, 174, 175, 176, 178, 179, 180, 201, 202, 203, 204, 205, 206, 207, 208, 211, 227, 229, 230, 231, 232, 233, 235, 256, 257, 258, 259, 260, 263, 285, 286, 287, 288, 290, 291, 293, 294, 295, 297, 302, 312, 313, 314, 315, 316, 319, 322, 340, 341, 342, 343, 344, 347, 369, 370, 371, 372, 374, 375, 381, 395, 397, 398, 399, 400, 401, 402, 403, 407, 424, 425, 426, 427, 428 |
| 3D-footprint Homologues: | 2i13_A, 7y3l_A, 7n5w_A, 3uk3_C, 6jnm_A, 8cuc_F, 4x9j_A, 6u9q_A, 5ei9_F, 5k5i_A, 8ssq_A, 1g2f_F, 8ssu_A, 8h9h_G, 7eyi_G, 7y3m_I, 6ml4_A, 7w1m_H, 5k5l_F, 5v3j_F, 4m9v_C, 5yj3_D, 6wmi_A, 1tf3_A, 1tf6_A, 8gn3_A, 1llm_D, 1mey_C, 5und_A, 2gli_A, 1ubd_C, 6blw_A, 5kkq_D, 6e94_A, 7ysf_A, 5yel_A, 6a57_A, 2jpa_A, 2kmk_A, 2wbs_A, 7txc_E, 5kl3_A, 1f2i_J, 2lt7_A, 2drp_D |
| Binding Motifs: | UN0678.1 trwkCAGGGTCCTdsv UN0678.2 kCAGGGTCCT |
| Binding Sites: | UN0678.1.1 / UN0678.1.2 UN0678.1.10 / UN0678.1.11 UN0678.1.11 / UN0678.1.13 UN0678.1.12 / UN0678.1.16 UN0678.1.13 / UN0678.1.17 UN0678.1.14 / UN0678.1.19 UN0678.1.15 UN0678.1.16 UN0678.1.17 UN0678.1.18 UN0678.1.19 UN0678.1.2 / UN0678.1.3 UN0678.1.20 UN0678.1.3 / UN0678.1.4 UN0678.1.4 / UN0678.1.5 UN0678.1.5 / UN0678.1.6 UN0678.1.6 / UN0678.1.7 UN0678.1.7 / UN0678.1.8 UN0678.1.8 / UN0678.1.9 UN0678.1.10 / UN0678.1.9 UN0678.1.1 UN0678.1.12 UN0678.1.14 UN0678.1.15 UN0678.1.18 UN0678.1.20 UN0678.2.1 / UN0678.2.13 / UN0678.2.4 / UN0678.2.8 UN0678.2.10 / UN0678.2.11 / UN0678.2.14 / UN0678.2.17 / UN0678.2.5 UN0678.2.12 UN0678.2.15 UN0678.2.16 UN0678.2.18 UN0678.2.19 UN0678.2.2 UN0678.2.20 UN0678.2.3 UN0678.2.6 UN0678.2.7 UN0678.2.9 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.