Transcription Factor
| Accessions: | PAX7_DBD (HumanTF 1.0), PAX7 (HT-SELEX2 May2017) |
| Names: | HuP1, Paired box protein Pax-7, PAX7, PAX7_HUMAN, ENSG00000009709 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P23759 |
| Notes: | Ensembl ID: ENSG00000009709; DNA-binding domain sequence; TF family: PAX+Homeodomain; Clone source: Gene synthesis, TF family: PAX_homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: PAX_homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: PAX_homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: PAX_homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 291 |
| Pfam Domains: | 19-146 'Paired box' domain 203-259 Homeobox domain 226-256 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 PGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQ 60 61 LRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRD 120 121 RLLKDGHCDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDK 180 181 GNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTK 240 241 LTEARVQVWFSNRRARWRKQAGANQLAAFNHLLPGGFPPTGMPTLPPYQLP |
| Interface Residues: | 32, 64, 65, 67, 69, 70, 86, 89, 92, 135, 138, 139, 140, 142, 143, 146, 202, 203, 204, 205, 206, 244, 245, 247, 248, 251, 252, 255, 256, 259 |
| 3D-footprint Homologues: | 1pdn_C, 6pax_A, 1k78_A, 4j19_B, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1fjl_B, 1puf_B, 6a8r_A, 3d1n_M, 1zq3_P, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 2ld5_A, 7q3o_C, 5jlw_D, 4cyc_A, 6es3_K, 4xrs_G, 3l1p_A, 3a01_E, 5flv_I, 5zjt_E, 1au7_A, 2hdd_A, 5hod_A, 3rkq_B, 2r5y_A, 1b72_A, 2hos_A, 7psx_B, 2xsd_C, 1le8_A, 1e3o_C, 7xrc_C, 1du0_A, 1le8_B, 1k61_B, 4qtr_D, 1mnm_C, 8g87_X, 4xrm_B |
| Binding Motifs: | PAX7_DBD wAATyrATTA PAX7_10 aTAATYGATTAt PAX7_11 cgATTmGTCACGstt PAX7_12 ysGTCACGsywATTAr PAX7_4 rtAATyGATTay PAX7_5 yrATTCGTCACGsty PAX7_6 ysGTCACGsyTrTTAr PAX7_methyl_1 dtAATyGATTwt PAX7_methyl_2 crATTmGTCACGstw PAX7_methyl_3 ysGTCACGsttrTTAr PAX7_methyl_7 aTAATYGATTAt PAX7_methyl_8 yraTTaGTCACGstw PAX7_methyl_9 ysGTCACGSywATTAr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.