Transcription Factor

Accessions: 4y60_C (3D-footprint 20260701)
Names: SOX18_MOUSE, Transcription factor SOX-18
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P43680
Length: 76
Pfam Domains: 4-72 HMG (high mobility group) box
5-65 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 GLRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERL 60
61 RVQHLRDHPNYKYRPR
Interface Residues: 6, 9, 11, 12, 15, 19, 30, 31, 32, 35, 73
3D-footprint Homologues: 4s2q_D, 1o4x_B, 3f27_D, 4y60_C, 1qrv_A, 3tmm_A, 7m5w_A, 2gzk_A, 3u2b_C, 1j5n_A, 2lef_A, 1hry_A
Binding Motifs: 4y60_C ACAATg
Binding Sites: 4y60_A
4y60_B
Publications: Klaus M, Prokoph N, Girbig M, Wang X, Huang YH, Srivastava Y, Hou L, Narasimhan K, Kolatkar PR, Francois M, Jauch R. Structure and decoy-mediated inhibition of the SOX18/Prox1-DNA interaction. Nucleic Acids Res 44:3922-35 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.