Transcription Factor
| Accessions: | 4y60_C (3D-footprint 20260701) |
| Names: | SOX18_MOUSE, Transcription factor SOX-18 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P43680 |
| Length: | 76 |
| Pfam Domains: | 4-72 HMG (high mobility group) box 5-65 Domain of unknown function (DUF1898) |
| Sequence: (in bold interface residues) | 1 GLRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERL 60 61 RVQHLRDHPNYKYRPR |
| Interface Residues: | 6, 9, 11, 12, 15, 19, 30, 31, 32, 35, 73 |
| 3D-footprint Homologues: | 4s2q_D, 1o4x_B, 3f27_D, 4y60_C, 1qrv_A, 3tmm_A, 7m5w_A, 2gzk_A, 3u2b_C, 1j5n_A, 2lef_A, 1hry_A |
| Binding Motifs: | 4y60_C ACAATg |
| Binding Sites: | 4y60_A 4y60_B |
| Publications: | Klaus M, Prokoph N, Girbig M, Wang X, Huang YH, Srivastava Y, Hou L, Narasimhan K, Kolatkar PR, Francois M, Jauch R. Structure and decoy-mediated inhibition of the SOX18/Prox1-DNA interaction. Nucleic Acids Res 44:3922-35 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.