Transcription Factor
| Accessions: | T144595_1.02 (CISBP 1.02), Q61473 (JASPAR 2024) |
| Names: | Sox17, T144595_1.02;, SOX17_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:Sox |
| Length: | 419 |
| Pfam Domains: | 68-136 HMG (high mobility group) box 68-130 Domain of unknown function (DUF1898) 202-322 Sox C-terminal transactivation domain 327-417 Sox C-terminal transactivation domain |
| Sequence: (in bold interface residues) | 1 MSSPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSG 60 61 RAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEE 120 121 AERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLG 180 181 LPFPEPGYPAGPPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAAP 240 241 LPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPAMPGILAPPSALHLYYGAMGS 300 301 PAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSPPPEALPCRDGTESNQPTELL 360 361 GEVDRTEFEQYLPFVYKPEMGLPYQGHDCGVNLSDSHGAISSVVSDASSAVYYCNYPDI |
| Interface Residues: | 70, 73, 75, 76, 79, 83, 94, 95, 96, 99, 137, 141 |
| 3D-footprint Homologues: | 3u2b_C, 2gzk_A, 4s2q_D, 1j5n_A, 2lef_A, 4y60_C, 1o4x_B, 3f27_D, 7m5w_A, 1qrv_A, 1hry_A |
| Binding Motifs: | PB0170.1 gwycacATTCAtryrat MA0078.1 yhyATTGTs M1586_1.02 ATTswtyyw PB0066.1 mwaAACAATTrAwhw MA0078.2 rvagAACAATGGmm MA0078.3 agAACAATGG |
| Binding Sites: | MA0078.1.1 / MA0078.1.2 MA0078.1.10 MA0078.1.11 MA0078.1.12 MA0078.1.13 MA0078.1.14 MA0078.1.15 MA0078.1.16 MA0078.1.17 MA0078.1.18 MA0078.1.19 MA0078.1.20 MA0078.1.3 MA0078.1.4 MA0078.1.5 MA0078.1.6 MA0078.1.7 MA0078.1.8 MA0078.1.9 MA0078.2.1 MA0078.2.10 / MA0078.2.13 MA0078.2.11 / MA0078.2.15 MA0078.2.12 / MA0078.2.16 MA0078.2.13 / MA0078.2.17 MA0078.2.14 / MA0078.2.18 MA0078.2.15 / MA0078.2.20 MA0078.2.16 MA0078.2.17 MA0078.2.18 MA0078.2.19 MA0078.2.2 MA0078.2.20 MA0078.2.3 MA0078.2.3 / MA0078.2.4 MA0078.2.4 / MA0078.2.5 MA0078.2.6 MA0078.2.7 / MA0078.2.9 MA0078.2.10 / MA0078.2.8 MA0078.2.11 / MA0078.2.9 MA0078.2.12 MA0078.2.14 MA0078.2.19 MA0078.2.5 MA0078.2.7 MA0078.2.8 MA0078.3.1 MA0078.3.10 MA0078.3.11 MA0078.3.12 MA0078.3.13 / MA0078.3.20 MA0078.3.14 MA0078.3.15 MA0078.3.16 MA0078.3.17 MA0078.3.18 MA0078.3.19 MA0078.3.2 MA0078.3.3 MA0078.3.4 MA0078.3.5 MA0078.3.6 MA0078.3.7 MA0078.3.8 MA0078.3.9 |
| Publications: | Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] Kanai Y, Kanai-Azuma M, Noce T, Saido T.C, Shiroishi T, Hayashi Y, Yazaki K. Identification of two Sox17 messenger RNA isoforms, with and without the high mobility group box region, and their differential expression in mouse spermatogenesis. The Journal of cell biology 133:667-81 (1996). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.