Transcription Factor
Accessions: | HOXA2_DBD (HumanTF 1.0), HOXA2_TF2 (HumanTF2 1.0) |
Names: | Homeobox protein Hox-1K, Homeobox protein Hox-A2, HOXA2, HXA2_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Uniprot: | O43364 |
Notes: | Ensembl ID: ENSG00000105996; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, Ensembl ID: ENSG00000105996; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013 |
Length: | 153 |
Pfam Domains: | 74-130 Homeobox domain |
Sequence: (in bold interface residues) | 1 MAPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHK 60 61 ESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVW 120 121 FQNRRMKHKRQTQCKENQNSEGKCKSLEDSEKV |
Interface Residues: | 74, 75, 76, 77, 115, 116, 118, 119, 122, 123, 126, 127, 130 |
3D-footprint Homologues: | 3cmy_A, 5zfz_A, 1fjl_B, 3d1n_M, 1ig7_A, 6a8r_A, 2h1k_B, 1puf_A, 1nk2_P, 1zq3_P, 1jgg_B, 3lnq_A, 2lkx_A, 2ld5_A, 6es3_K, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 1puf_B, 6m3d_C, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 4cyc_A, 7psx_B, 5hod_A, 3l1p_A, 3a01_E, 7q3o_C, 5jlw_D, 1e3o_C, 1le8_A, 7xrc_C, 1au7_A, 2xsd_C, 8g87_X, 1o4x_A, 1du0_A, 4qtr_D |
Binding Motifs: | HOXA2_DBD ssymATTAsc ETV2_HOXA2_1 acCGGAAGTmaTta ETV2_HOXA2_2 rcCGGAwryrawrgymATTA ETV5_HOXA2_1 rsCGGAwGTmATTA ETV5_HOXA2_2 rscGGwAATgrstdwdsymaTtA ETV5_HOXA2_2_3 rsCGGwArTkr- GCM1_HOXA2 rTrsGGGygTrATkr TEAD4_HOXA2_1 rCATwCcrwdstmATTA TEAD4_HOXA2_2 rCATwCCrawctmATTA |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.