Transcription Factor

Accessions: HOXA2_DBD (HumanTF 1.0), HOXA2_TF2 (HumanTF2 1.0)
Names: Homeobox protein Hox-1K, Homeobox protein Hox-A2, HOXA2, HXA2_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: O43364
Notes: Ensembl ID: ENSG00000105996; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, Ensembl ID: ENSG00000105996; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013
Length: 153
Pfam Domains: 74-130 Homeobox domain
Sequence:
(in bold interface residues)
1 MAPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHK 60
61 ESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVW 120
121 FQNRRMKHKRQTQCKENQNSEGKCKSLEDSEKV
Interface Residues: 74, 75, 76, 77, 113, 114, 115, 116, 118, 119, 122, 123, 125, 126, 127, 130
3D-footprint Homologues: 8pmf_A, 2glo_A, 8ejp_B, 1zq3_P, 2lkx_A, 2ld5_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 6es3_K, 6m3d_C, 9b8u_A, 8ik5_C, 7psx_B, 2hdd_A, 4cyc_A, 7xrc_C, 8g87_X, 8bx1_A
Binding Motifs: HOXA2_DBD ssymATTAsc
ETV2_HOXA2_1 acCGGAAGTmaTta
ETV2_HOXA2_2 rcCGGAwryrawrgymATTA
ETV5_HOXA2_1 rsCGGAwGTmATTA
ETV5_HOXA2_2 rscGGwAATgrstdwdsymaTtA
ETV5_HOXA2_2_3 rsCGGwArTkr-
GCM1_HOXA2 rTrsGGGygTrATkr
TEAD4_HOXA2_1 rCATwCcrwdstmATTA
TEAD4_HOXA2_2 rCATwCCrawctmATTA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.