Transcription Factor
Accessions: | 1gtw_B (3D-footprint 20231221), 1gu4_B (3D-footprint 20231221), 1gu5_B (3D-footprint 20231221), 1h8a_B (3D-footprint 20231221), 1hjb_B (3D-footprint 20231221) |
Names: | C/EBP beta, CAAT/ENHANCER BINDING PROTEIN BETA, CCAAT/enhancer-binding protein beta, CEBPB_HUMAN, LAP, LIP, Liver activator protein, Liver-enriched inhibitory protein, Nuclear factor NF-IL6, TCF-5, Transcription factor 5, CCAAT/ENHANCER BINDING PROTEIN BETA |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P17676 |
Length: | 67 |
Pfam Domains: | 3-56 Basic region leucine zipper 4-62 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTL 60 61 RNLFKQL |
Interface Residues: | 11, 14, 15, 17, 18, 21, 22 |
3D-footprint Homologues: | 1nwq_C, 6mg1_B, 2c9l_Z, 2dgc_A |
Binding Motifs: | 1gtw_AB gTGGCGyAAk 1gtw_B gTGGC 1gu4_AB TTrCGCAA 1gu4_B TTGc 1gu5_AB rTTGncCAA 1gu5_B cAAc 1h8a_ABC TCCGTTAnnnGTTGCGCCAC 1hjb_ABC TTTCCAAAnnnTGTGGTTG |
Binding Sites: | 1gtw_C 1gtw_D 1gu4_C 1gu4_D 1gu5_C 1gu5_D 1h8a_D 1h8a_E |
Publications: | Tahirov T.H, Sato K, Ichikawa-Iwata E, Sasaki M, Inoue-Bungo T, Shiina M, Kimura K, Takata S, Fujikawa A, Morii H, Kumasaka T, Yamamoto M, Ishii S, Ogata K. Mechanism of c-Myb-C/EBP beta cooperation from separated sites on a promoter. Cell 108:57-70 (2002). [Pubmed] Tahirov T.H, Inoue-Bungo T, Morii H, Fujikawa A, Sasaki M, Kimura K, Shiina M, Sato K, Kumasaka T, Yamamoto M, Ishii S, Ogata K. Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta. Cell 104:755-67 (2001). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.