Transcription Factor

Accessions: LBX2_DBD (HumanTF 1.0), LBX2 (HT-SELEX2 May2017)
Names: Ladybird homeobox protein homolog 2, LBX2, LBX2_HUMAN, Transcription factor LBX2, ENSG00000179528
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q6XYB7
Notes: Ensembl ID: ENSG00000179528; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 158
Pfam Domains: 69-125 Homeobox domain
Sequence:
(in bold interface residues)
1 DILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGRAGPDALG 60
61 PGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRR 120
121 AKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPG
Interface Residues: 69, 70, 71, 72, 110, 111, 113, 114, 117, 118, 121, 122, 125
3D-footprint Homologues: 1ig7_A, 3d1n_M, 2h1k_B, 1puf_A, 1fjl_B, 6a8r_A, 3cmy_A, 5zfz_A, 1zq3_P, 1jgg_B, 3lnq_A, 2lkx_A, 1nk2_P, 2ld5_A, 7q3o_C, 6es3_K, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 5zjt_E, 4cyc_A, 7psx_B, 5hod_A, 3a01_E, 1b72_A, 5jlw_D, 1puf_B, 4xrs_G, 2hdd_A, 3rkq_B, 1e3o_C, 2xsd_C, 2h8r_B, 1le8_A, 1ic8_B, 7xrc_C, 1o4x_A, 8g87_X, 3l1p_A, 4qtr_D, 1du0_A
Binding Motifs: LBX2_DBD_1 cTsrAystrATTA
LBX2_DBD_2 rcyAATTArc
LBX2_4 CymrTTAATTAg
LBX2_5 CTyrTTAa
LBX2_6 sCyAATTArc
LBX2_methyl_1 cTmATTAATTAT
LBX2_methyl_2 CTCrTTAa
LBX2_methyl_3 vyyMATTArc
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.