Transcription Factor
Accessions: | 4rb3_D (3D-footprint 20231221) |
Names: | DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family), V6F4Q0_MAGGM |
Organisms: | Magnetospirillum gryphiswaldense, strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | V6F4Q0 |
Length: | 133 |
Pfam Domains: | 11-129 Ferric uptake regulator family |
Sequence: (in bold interface residues) | 1 VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRL 60 61 FEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFR 120 121 LVGHRLELYGVPL |
Interface Residues: | 14, 36, 50, 51, 52, 53, 55, 56, 59, 60, 63, 71, 77 |
3D-footprint Homologues: | 7vpz_N, 4rb3_D, 7vo0_N, 7x74_H, 6jgx_B, 1k82_A |
Binding Motifs: | 4rb3_CD TGCAAAnnnTTTGCAnnnA 4rb3_D TnnnTGCAAA |
Binding Sites: | 4rb3_A 4rb3_B |
Publications: | Deng Z, Wang Q, Liu Z, Zhang M, Machado AC, Chiu TP, Feng C, Zhang Q, Yu L, Qi L, Zheng J, Wang X, Huo X, Qi X, Li X, Wu W, Rohs R, Li Y, Chen Z. Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator. Nat Commun : (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.