Transcription Factor
| Accessions: | 5k5j_A (3D-footprint 20250804) |
| Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P49711 |
| Length: | 114 |
| Pfam Domains: | 4-26 Zinc finger, C2H2 type 4-27 C2H2-type zinc-finger domain 4-26 C2H2-type zinc finger 19-43 Zinc-finger double domain 32-55 C2H2-type zinc finger 62-85 C2H2-type zinc finger 62-85 Zinc finger, C2H2 type 93-114 C2H2-type zinc finger 93-114 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 GSPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVA 60 61 KFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSH |
| Interface Residues: | 4, 14, 15, 16, 17, 18, 20, 21, 22, 29, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 72, 73, 74, 75, 76, 79, 82, 83, 103, 104, 105, 106, 107, 109 |
| 3D-footprint Homologues: | 2kmk_A, 1tf3_A, 7ysf_A, 6ml4_A, 8cuc_F, 1g2f_F, 7y3l_A, 7n5w_A, 3uk3_C, 6a57_A, 5k5i_A, 5v3j_F, 1f2i_J, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 8ssu_A, 5kkq_D, 1ubd_C, 8gn3_A, 5ei9_F, 2jpa_A, 1llm_D, 6jnm_A, 5kl3_A, 4m9v_C, 8h9h_G, 8ssq_A, 7w1m_H, 2lt7_A, 2gli_A, 6e94_A, 7y3m_I, 1yuj_A, 7txc_E, 2drp_D, 2wbs_A, 5yj3_D, 5yel_A, 5k5l_F |
| Binding Motifs: | 5k5j_A CCCTGCTGG |
| Binding Sites: | 5k5j_B 5k5j_C |
| Publications: | Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.