Transcription Factor

						

			
Accessions: 6chv_G (3D-footprint 20231221)

			
Names: Antidote protein, Antitoxin HigA, HIGA_PROVU, Host inhibition of growth protein A
Organisms: Proteus vulgaris
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q7A224
Length: 91
Pfam Domains:     12-61 Helix-turn-helix
Sequence: 
(in bold interface residues)		   1 VSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPE   60
  61 FWLRLQSNYDLRQLENQIDTSGIVLYGESNE
Interface Residues: 19, 20, 29, 30, 31, 32, 34, 35, 40, 41, 46
3D-footprint Homologues: 1per_L, 6chv_D, 6fix_D, 7csw_B
Binding Motifs: 6chv_GH TACAnnnnnTGTaanA
			
Publications: Schureck MA, Meisner J, Hoffer ED, Wang D, Onuoha N, Ei Cho S, Lollar P 3rd, Dunham CM. Structural basis of transcriptional regulation by the HigA antitoxin. Mol Microbiol 111:1449-1462 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.