Transcription Factor

Accessions: 3uk3_D (3D-footprint 20241219), 4is1_D (3D-footprint 20241219)
Names: Zinc finger protein 217, ZN217_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O75362
Length: 54
Pfam Domains: 3-24 Zinc finger, C2H2 type
3-24 C2H2-type zinc finger
17-40 Zinc-finger double domain
30-53 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SRECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHK
Interface Residues: 10, 12, 13, 14, 15, 16, 18, 19, 21, 22, 25, 27, 41, 42, 43, 44, 45, 46, 47, 48, 51
3D-footprint Homologues: 8gn3_A, 2kmk_A, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 7ysf_A, 6e94_A, 1ubd_C, 6u9q_A, 2lt7_A, 2gli_A, 8ssu_A, 5v3j_F, 1tf6_A, 7txc_E, 8h9h_G, 7w1m_H, 8ssq_A, 8gh6_A, 7y3m_I, 2jpa_A, 1yuj_A
Binding Motifs: 3uk3_CD TGCAGAATnnATTCTGCA
4is1_CD TGCAGAATnnATTCTGCA
4is1_D TGCAGAAT
Binding Sites: 3uk3_A / 3uk3_B / 4is1_A / 4is1_B
Publications: Vandevenne M, Jacques D.A, Artuz C, Nguyen C.D, Kwan A.H, Segal D.J, Matthews J.M, Crossley M, Guss J.M, Mackay J.P. New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217. The Journal of biological chemistry 288:10616-27 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.