Transcription Factor
| Accessions: | Q9C8P8 (JASPAR 2024), T05163 (AthalianaCistrome v4_May2016) |
| Names: | AtbHLH80, Basic helix-loop-helix protein 80, BH080_ARATH, bHLH 80, bHLH transcription factor bHLH080, Transcription factor bHLH80, Transcription factor EN 71, AT1G35460, bHLH80, T05163; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:bHLH |
| Length: | 259 |
| Pfam Domains: | 193-238 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MQSTHISGGSSGGGGGGGGEVSRSGLSRIRSAPATWIETLLEEDEEEGLKPNLCLTELLT 60 61 GNNNSGGVITSRDDSFEFLSSVEQGLYNHHQGGGFHRQNSSPADFLSGSGSGTDGYFSNF 120 121 GIPANYDYLSTNVDISPTKRSRDMETQFSSQLKEEQMSGGISGMMDMNMDKIFEDSVPCR 180 181 VRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEYVKALQSQ 240 241 IQELTEQQKRCKCKPKEEQ |
| Interface Residues: | 63, 192, 193, 195, 196, 199, 200 |
| 3D-footprint Homologues: | 7b5y_B, 1am9_A, 6g1l_A, 7d8t_A, 5t01_B, 7f2f_B, 5gnj_I |
| Binding Motifs: | M0161 / MA1357.1 tGCAAGTkGcw M0163 wkCmACTTGCa MA1357.2 tGCAAGTkG |
| Binding Sites: | MA1357.1.1 MA1357.1.10 MA1357.1.11 MA1357.1.12 MA1357.1.13 MA1357.1.14 MA1357.1.15 MA1357.1.16 MA1357.1.17 MA1357.1.18 MA1357.1.19 MA1357.1.2 MA1357.1.20 MA1357.1.3 MA1357.1.4 MA1357.1.5 MA1357.1.6 MA1357.1.7 MA1357.1.8 MA1357.1.9 MA1357.2.1 MA1357.2.10 MA1357.2.11 MA1357.2.12 MA1357.2.13 MA1357.2.14 MA1357.2.15 MA1357.2.16 MA1357.2.17 MA1357.2.18 MA1357.2.19 MA1357.2.2 MA1357.2.20 MA1357.2.3 MA1357.2.4 MA1357.2.5 MA1357.2.6 MA1357.2.7 MA1357.2.8 MA1357.2.9 |
| Publications: | Fernández-Calvo P, Chini A, Fernández-Barbero G, Chico J.M, Gimenez-Ibanez S, Geerinck J, Eeckhout D, Schweizer F, Godoy M, Franco-Zorrilla J.M, Pauwels L, Witters E, Puga M.I, Paz-Ares J, Goossens A, Reymond P, De Jaeger G, Solano R. The Arabidopsis bHLH transcription factors MYC3 and MYC4 are targets of JAZ repressors and act additively with MYC2 in the activation of jasmonate responses. The Plant cell 23:701-15 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.