Transcription Factor

Accessions: 1pdn_C (3D-footprint 20231221)
Names: PRD PAIRED, PRD_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06601
Length: 123
Pfam Domains: 1-123 'Paired box' domain
21-60 Homeodomain-like domain
Sequence:
(in bold interface residues)
1 QGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETG 60
61 SIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAIS 120
121 RLV
Interface Residues: 13, 45, 46, 48, 50, 51, 67, 70, 73, 115, 116, 117, 118, 120, 121
3D-footprint Homologues: 1k78_A, 1pdn_C, 6pax_A
Binding Motifs: 1pdn_C CnTnACG
Binding Sites: 1pdn_A
1pdn_B
Publications: Xu W, Rould M.A, Jun S, Desplan C, Pabo C.O. Crystal structure of a paired domain-DNA complex at 2.5 A resolution reveals structural basis for Pax developmental mutations. Cell 80:639-50 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.