Transcription Factor

Accessions: 6jnl_A (3D-footprint 20260701), 6jnm_A (3D-footprint 20260701), 6jnn_A (3D-footprint 20260701), 6jnn_B (3D-footprint 20260701), 6jnn_N (3D-footprint 20260701)
Names: EC 1.14.11.-, Jumonji domain-containing protein 12, Lysine-specific demethylase REF6, Lysine-specific histone demethylase REF6, Protein RELATIVE OF EARLY FLOWERING 6, REF6_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9STM3
Length: 89
Pfam Domains: 3-26 C2H2-type zinc finger
4-26 Zinc finger, C2H2 type
19-44 Zinc-finger double domain
33-56 C2H2-type zinc finger
50-73 Zinc-finger double domain
62-88 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 RNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGAR 60
61 PYVCAEPDCGQTFRFVSDFSRHKRKTGHS
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 23, 24, 25, 27, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 74, 75, 76, 77, 78, 79, 80, 81, 82
3D-footprint Homologues: 6jnm_A, 1tf3_A, 6ml4_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 2gli_A, 5kl3_A, 7txc_E, 5ei9_F, 1f2i_J, 7ysf_A, 6blw_A, 2kmk_A, 1g2f_F, 6u9q_A, 1ubd_C, 5kkq_D, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 7w1m_H, 2wbs_A, 1tf6_A, 8ssq_A, 5k5i_A, 5yel_A, 1llm_D, 8gn3_A, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: 6jnl_A aCAGAG
6jnn_B aACAGA
6jnm_A CTnTGTt
6jnn_AN AywGAknnnnTCTGTA
Binding Sites: 6jnl_C / 6jnm_C / 6jnn_E
6jnl_D
6jnn_F
6jnm_D
6jnn_H
6jnn_I
Publications: Qiu Q, Mei H, Deng X, He K, Wu B, Yao Q, Zhang J, Lu F, Ma J, Cao X. DNA methylation repels targeting of Arabidopsis REF6. Nat Commun 10:2063 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.