Transcription Factor
| Accessions: | 6jnl_A (3D-footprint 20250804), 6jnm_A (3D-footprint 20250804), 6jnn_A (3D-footprint 20250804), 6jnn_B (3D-footprint 20250804), 6jnn_N (3D-footprint 20250804) |
| Names: | EC 1.14.11.-, Jumonji domain-containing protein 12, Lysine-specific demethylase REF6, Lysine-specific histone demethylase REF6, Protein RELATIVE OF EARLY FLOWERING 6, REF6_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9STM3 |
| Length: | 89 |
| Pfam Domains: | 3-26 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 19-44 Zinc-finger double domain 33-56 C2H2-type zinc finger 50-73 Zinc-finger double domain 62-88 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 RNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGAR 60 61 PYVCAEPDCGQTFRFVSDFSRHKRKTGHS |
| Interface Residues: | 14, 15, 16, 17, 18, 20, 21, 23, 24, 25, 27, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 74, 75, 76, 77, 78, 79, 80, 81, 82 |
| 3D-footprint Homologues: | 1tf3_A, 6ml4_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 7txc_E, 5ei9_F, 1f2i_J, 7ysf_A, 6blw_A, 2kmk_A, 1g2f_F, 6u9q_A, 1ubd_C, 5kkq_D, 4x9j_A, 2gli_A, 5kl3_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 7w1m_H, 1tf6_A, 8ssq_A, 5k5i_A, 5yel_A, 1llm_D, 8gn3_A, 2wbs_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | 6jnl_A aCAGAG 6jnn_B aACAGA 6jnm_A CTnTGTt 6jnn_AN AywGAknnnnTCTGTA |
| Binding Sites: | 6jnl_C / 6jnm_C / 6jnn_E 6jnl_D 6jnn_F 6jnm_D 6jnn_H 6jnn_I |
| Publications: | Qiu Q, Mei H, Deng X, He K, Wu B, Yao Q, Zhang J, Lu F, Ma J, Cao X. DNA methylation repels targeting of Arabidopsis REF6. Nat Commun 10:2063 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.