Transcription Factor

Accessions: POU6F2_full (HumanTF 1.0)
Names: PO6F2_HUMAN, POU domain, class 6, transcription factor 2, POU6F2, Retina-derived POU domain factor 1, RPF-1
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P78424
Notes: Ensembl ID: ENSG00000106536; Full protein sequence; TF family: homeodomain+POU; Clone source: Megaman
Length: 143
Sequence:
(in bold interface residues)
1 ASQAAAAAAAMSSIASSQAFGNALSSLQGVTGQLVTNAQGQIIGTIPLMPNPGPSSQAAS 60
61 GTQGLQVQPITPQLLTNAQGQIIATVIGNQILPVINTQGITLSPIKPGQQILKRQRVRWM 120
121 GLIWRRSENLPKLLKSGACPLA*
Interface Residues: 11, 12, 22, 23, 25, 26
3D-footprint Homologues: 3zql_B
Binding Motifs: POU6F2_full sCTMATTAgw
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.